Loading...
HomeMy WebLinkAbout0006_7_PA 2016-107 - Exhibit F Design Review PackageGARAGE20'-4" x 20'-1"KITCHEN12'-0" x 9'-8"ROOM15'-10" x 10'-3"DININGROOM18'-6" x 14'-1"FAMILYENTRYPORCH14'-0" x 6'-0"PDR.STORAGE M. BEDROOM15'-4" x 14'-1"W.I.C.BEDROOM 210'-0" x 10'-9"BEDROOM 310'-0" x 12'-5"BEDROOM 412'-4" x 12'-5"LAUN.M. BATH6'-4" x 5'-4"LOFT/ OPT.BEDROOM 410'-0" x 12'-5" ALL ROOF PITCH ARE : 4/12 U.N.O.1. Stucco FinishBuilding Materials4. Spanish Style Clay Accent Vent3. 2" Buildout Stucco Wainscot2. Low Profile 'S' Concrete Roof Tile5. Accent Color Window and Door Trim6. Decorative Exterior Lights7. Fiberglass Shutters as applies Building Materials3. Brick Accent Columns & Wainscot2. Concrete Flat Tile Roofing1. Stucco Finish4. Accent Color Window and Door Trim5. Decorative Exterior Lights6. Fiberglass Shutters as appliesALL ROOF PITCH ARE : 4/12 U.N.O. ALL ROOF PITCH ARE : 4/12 U.N.O.Building Materials1. Stucco Finish and Harboard Siding2. Concrete Flat Tile Roofing3. Stone Accent Columns & Wainscot4. 6x12 Wood Corbels5. Accent Color Window & Door Trim6. Decorative Exterior Lights7. Fiberglass Shutters as applies GARAGE20'-0" x 20'-0"KITCHEN10'-4" x 15'-0"ROOM10'-0" x 15'-0"DININGROOM14'-0" x 17'-0"FAMILYENTRYPORCH5'-2" x 10'-0"BEDROOM 510'-0" x 10'-0"BATH 3 M. BEDROOM14'-8" x 17'-0"W.I.C.BEDROOM 210'-4" x 12'-0"BEDROOM 3BEDROOM 414'-8" x 12'-6"LAUN.BATH 2M. BATH6'-4" x 5'-6"LOFT/ OPT.11'-8" x 11'-8"BEDROOM 412'-4" x 12'-6" ALL ROOF PITCH ARE : 4/12 U.N.O.1. Stucco FinishBuilding Materials4. Spanish Style Clay Accent Vent3. 2" Buildout Stucco Wainscot2. Low Profile 'S' Concrete Roof Tile5. Accent Color Window and Door Trim6. Decorative Exterior Lights7. Fiberglass Shutters as applies Building Materials3. Brick Accent Columns & Wainscot2. Concrete Flat Tile Roofing1. Stucco Finish4. Accent Color Window and Door Trim5. Decorative Exterior Lights6. Fiberglass Shutters as appliesALL ROOF PITCH ARE : 4/12 U.N.O. ALL ROOF PITCH ARE : 4/12 U.N.O.Building Materials1. Stucco Finish and Harboard Siding2. Concrete Flat Tile Roofing3. Stone Accent Columns & Wainscot4. 6x12 Wood Corbels5. Accent Color Window & Door Trim6. Decorative Exterior Lights7. Fiberglass Shutters as applies PORCH14'-0" x 5'-6"ENTRYLIVINGROOMKITCHEN13'-8" x 15'-0"10'-2" x 17'-8"ROOM24'-2" x 17'-8"GREATGARAGE20'-4" x 20'-0"BATH 3BEDROOM 410'-0" x 11'-0"HALL BEDROOM16'-6" x 15'-0"MASTERBATHMASTERBEDROOM 310'-0" x 10'-10"BEDROOM 210'-0" x 10'-10"W.I.C.HALLBEDROOM 513'-8" x 12'-2"LAUNDRY6'-6" x 9'-0"BATH 2LOFT/13'-8" x 11'-0"BEDROOM 5 1. Stucco FinishBuilding Materials4. Spanish Style Clay Accent Vent3. 2" Buildout Stucco Wainscot2. Low Profile 'S' Concrete Roof Tile5. Accent Color Window and Door Trim6. Decorative Exterior Lights7. Fiberglass Shutters as appliesALL ROOF PITCH ARE : 4/12 U.N.O. Building Materials3. Brick Accent Columns & Wainscot2. Concrete Flat Tile Roofing1. Stucco Finish4. Accent Color Window and Door Trim5. Decorative Exterior Lights6. Fiberglass Shutters as appliesALL ROOF PITCH ARE : 4/12 U.N.O. Building Materials1. Stucco Finish and Harboard Siding2. Concrete Flat Tile Roofing3. Stone Accent Columns & Wainscot4. 6x12 Wood Corbels5. Accent Color Window & Door Trim6. Decorative Exterior Lights7. Fiberglass Shutters as appliesALL ROOF PITCH ARE : 4/12 U.N.O. Frontier Homes, Lake ElsinorePlan 1A, 1B & 1C Lisa Strauss December 10th, 2016 Plan 1A, Scheme 1 Plan 1B, Cottage, Scheme 7 Plan 1C, Craftsman, Scheme 2 Frontier Homes, Lake ElsinorePlan 2A, 2B & 2C Lisa Strauss December 5th, 2016 Plan 2A, Spanish, Scheme 4 Plan 2B, Cottage, Scheme 8 Plan 2C, Craftsman, Scheme 3 Frontier Homes, Lake ElsinorePlan 3A, 3B & 3C Lisa Strauss December 5th, 2016 Plan 3A, Spanish, Scheme 5 Plan 3B, Cottage, Scheme 9 Plan 3C, Craftsman, Scheme 6 SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996TYPICAL PLANPLOT DATE DECEMBER 27 20168 TITLE SHEET190'4&'8'.12'4(4106+'4%1//70+6+'576+%##8'07'57+6'4#0%*1%7%#/10)#%#%106#%62'4510/#66*'9'537+8'.241,'%62.#00'41((+%'ÄÄ.#0&5%#2'#4%*+6'%6.#06':.#0&5%#2'#4%*+6'%674'Ä2.#00+0)%#/+01%#2+564#0157+6'.#)70#0+)7'.%#  Ä%106#%62'4510$.#-'*+0/#0'/#+.#&&4'55$.#-'*+0/#0".#06':.#%1/T-1'0)+0''45&'0)+0''4+0)#0&#551%+#6'5'#+42146&4+8'56'5#0$'40#4&+01%#2*  Ä#660574'5*&1&&+#*+0&':/#2065SHEET I-1, P-1LAKE ELSINORE, CALIFORNIATYPICAL PLANSTRACT 32996SHEET INDEX6Ä+Ä+Ä+&Ä2Ä2&Ä5+Ä52Ä6+6.'5*''6+44+)#6+102.#0+44+)#6+10.')'0&+44+)#6+10&'6#+.52.#06+0)2.#02.#06+0)&'6#+.5+44+)#6+1052'%+(+%#6+1052.#06+0)52'%+(+%#6+1051 PLAN 3PLAN 2FAFFFFFFFFFFFFFFFAAAFFCRECREMMAPLAN 1FAFFFFFFFFAACREMSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996TYPICAL PLANPLOT DATE DECEMBER 27 20168IRRIGATION PLANI-12 MDCFEL or MDCFTEE W/ MDCF75FPT FITTING FOR CONNECTION BETWEEN PVC LATERAL LINES AND DRIP TUBINGRAIN BIRDP.O.C.DOMESTIC WATER METER FOR FUTURE RESIDENCE, EXISTING PER CIVIL DRAWINGS - SYMBOL NOT SHOWN. PRECIP.RATEPSIGPMMODEL NO. / DESCRIPTIONMANUFACT.SYMBOLIRRIGATION LEGEND WILKINS500HLR 1.25" PRESSURE REGULATOR (REQUIRED IF HOSE PRESSURE EXCEEDS 85PSI) SYMBOL NOT SHOWN. WATTSN/ATOROEVO-WS ET/ WEATHER SENSOR TO BE INCLUDED AND INSTALLED WITH THE CONTROLLER.AS APPROVEDAS APPROVEDAS APPROVEDPVC PIPE SCH. 40 AS SLEEVING, TWICE THE DIAMETER OF PIPE OR WIRE BUNDLE CARRIEDPVC PIPE 3/4" - 2" SCH. 40 AS LATERAL LINES 12" BELOW GRADEPVC PIPE 1.25" CL. 315 AS MAINLINES 18" BELOW GRADETOROPLACE BELOW ALL PAVING, HARDSCAPE, ETC., AND AS DIRECTED BY OWNER'S AUTHORIZED REPRESENTATIVE.120 VOLT ELECTRICAL POWER, PROVIDED BY ELECTRICIAN, VERIFY ACTUAL LOCATION IN FIELD3MK.B.I.AS APPROVEDK.B.I.IRRIGATION CONTROL WIRE #14UF AWG DIRECT BURIAL (U.L. APPROVED)WHEN RCV IS HIGHER THAN THE SPRINKLERSNO SYMBOLNO SYMBOLNO SYMBOLNO SYMBOLKC-XXX-S SPRING CHECK VALVE, LINE SIZE, 1 DOWNSTREAM OF EACH RCV IMMEDIATELY ABOVE FIRST LATERAL LINE TEE, KSC-XXX-S SWING CHECK VALVE, LINE SIZE, 1 DOWNSTREAM OF EACH RCV WHEN RCV IS LOWER THAN THE SPRINKLERSDBY DIRECT BURIAL WATER-PROOF WIRE CONNECTORS FOR USE ON ALL WIRE CONNECTIONSW20.5HUNTERRAIN BIRDNO SYMBOL0.95NO SYMBOLALL CONNECTIONS BETWEEN DRIP TUBING SHALL BE MADE USING "RAIN BIRD EASY FIT" FITTINGSRAIN BIRDRAIN BIRDRAIN BIRDGPMGPMGPMGPMGPMGPMGPM5 TO 100 TO 510 TO 1515 TO 2525 TO 3535 TO 5050 TO 100NOTE:3/4" CL. 200 PVC PIPE1" CL. 200 PVC PIPE1-1/2" CL. 200 PVC PIPE2" CL. 200 PVC PIPE2-1/2" CL. 200 PVC PIPE3" CL. 200 PVC PIPE1-1/4" CL. 200 PVC PIPEPIPE SIZING CHARTSIZE EXCEED DESIGNATED GPM RANGE.PIPE SIZING CHART, IN NO INSTANCE SHALL PIPE CONTRACTOR SHALL SIZE ALL LATERAL LINES PERVALVE TYPEVALVE NUMBERG.P.M.VALVE SIZERADIUS(.5 GPM)2 - BUBBLERTREESPLANT / GROUND COVER EMITTER LEGEND2 - 2.0 GPH2 - 2.0 GPH# OF EMITTERS / GPH2 - 1.0 GPH (2.0 GPH) RAINBIRD XB-10PC PLANT WATER TYPE USELOW MODERATE SHRUBSMODERATE SHRUBSLOW SHRUBS(4.0 GPH) RAINBIRD XB-20PC(4.0 GPH) RAINBIRD XB-20PCPOINT TO POINT DRIPTREE BUBBLERTOROTOROEZF-29-03 REMOTE CONTROL VALVE. XXXXXXXXIRRIGATION NOTESFRONT YARD TYPICAL NOTESSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996TYPICAL PLANPLOT DATE DECEMBER 27 20168IRRIGATION LEGENDI-13 SLEEVE TRENCHINGALL CURBS SHALL BE MARKED WITH A "SCORE" MARK TO DESIGNATE SLEEVE LOCATION.ALL PVC MAINLINE, PVC LATERAL LINES, AND CONTROL WIRES SHALL BE SLEEVED BELOW ALL HARDSCAPE ELEMENTS WITH SCH. 40 PVC, 2 TIMES THE DIAMETER OFTHE PIPE OR WIRE BUNDLE WITHIN.PLAN VIEW - N.T.S.NOTE:DEPTH BELOW GRADEDIMENSIONSECTION VIEW - N.T.S.EE24"A36"BEEADBC30 DEGREES, UNTIE AFTER ALL CONECTIONSCHANGES OF DIRECTION GREATER THAN TIE A 36" LOOP IN ALL WIRING AT HAVE BEEN MADE.IN SCH. 40 SLEEVE120 VOLT ELECTRICALEXISTING SOILBUNDLE CARRIED.OF THE PIPE OR WIRETWICE THE DIAMETERPVC SLEEVES TO BEIN SCH. 40 SLEEVEIN SCH. 40 SLEEVEIN SCH. 40 SLEEVECONTROL WIRESPRESSURE MAINLINELATERAL LINESTO THE DENSITY OFSAND BACKFILL COMPACTEDUNDISTURBED SOILPAVING OR D.G. PATH36"D36"C6"EESLEEVE DETAIL SHALL ALSO BE USED FOR INSTALLATION OF PIPE IN ROCK SOIL.BALL VALVE 2"FLOW4"SECTION VIEW - N.T.S.PLAN VIEW - N.T.S.WIRE CONNECTORLOCK TABS PREVENT WIRE REMOVAL INTO THE CONNECTIOR. TWIST CONNECTOR ONTO WIRES TO INSULATION PRIOR TO INSERTION PRE-STRIPPED OF 1/2" OF THE CONNECTOR. WIRES SHALL BESCOTCHLOK ELECTRICAL SPRINGONCE CONNECTOR IS INSERTEDCONNECTOR PASSES LOCK TABSSCOTCHLOK CONNECTOR AND WIRESINSERTED INTO TUBE UNTIL THE2 #12 PRE-STRIPPED COPPER WIRES. LARGER WIRES OR GREATER QUANTITIES OF WIRES DIRECT BURY SPLICE KIT SHALL BE USED TO ELECTRICALLY CONNECT 2 - 3 #14 OR KIT SHALL INCLUDE A SCOTCHLOK SPRING CONNECTOR, A POLYPROPYLENE TUBE AND A WIRE CONNECTOR SHALL BE A 3M DBY DIRECT BURY SPLICE KIT.WATERPROOF SEALING GEL. TUBE SHALL BE SUPPLIED PREFILLED WITH GEL.NOTE:SEAT FIRMLY.LOW VOLTAGE WIRES, 3 MAXIMUMCLOSE TUBE LID AFTER WIRETUBE LID TO ALLOW LID TO CLOSEWIRES PASS THROUGH GROOVES INIS INSERTED INTO TUBEPOLY TUBE PRE-FILLED WITHWATERPROOF GELSHALL REQUIRE A LARGER APPROVED WIRE CONNECTION.SECTION VIEW - N.T.S.24"24"PIPE AND WIRETRENCHING18"ALL PLASTIC PIPING SHALL BE SNAKED WITHIN TRENCH.BUNDLE WIRING AND WRAP WITH TAPE AT TEN FOOT INTERVALS.ALL MAINLINE PIPING TO BE INSTALLED IN ACCORDANCE WITH MANUFACTURERS3" AND LARGER2" TO 2 1/2" IN SIZE1/2" TO 1 1/2" SIZESECTION VIEW - N.T.S.INSTALLATION SPECIFICATIONS.NOTE:18"12"12"DIMENSIONAEEDFEABEBFC6"24"18"24"30"30"6"6"6"CLEAN SAND BACKFILL,UNDISTURBED SOILIN SCH. 40 CONDUITINSTALL AT MAINLINE DEPTH120 VOLT ELECTRICAL SPECIFICATIONSPRESSURE MAINLINE, SEECONTROL WIRES, SEE SPECS.LATERAL LINES, SEE SPECS.CLEAN COMPACTED BACKFILLCEDEFFINISHED GRADE6"6"SEE SPECIFICATIONSHOUSE CONNECTIONADRIP ANTI-SIPHON VALVEREMOTE CONTROLANTISIPHON VALVEBCDHGFCONTROLLERESHRUB POINT TO POINT DRIPIDRIP FLUSH VALVELAIR RELIEF VALVEJSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996TYPICAL PLANPLOT DATE DECEMBER 27 20168+44+)#6+10&'6#+.5+&Ä PLAN 3S-3S-2S-1S-3S-3S-3S-3S-3S-3S-2S-2S-2S-2S-2S-2S-2S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-3S-3S-3S-3S-3S-3S-3S-3S-3S-3S-3S-3S-3S-3S-3S-3PLAN 2STSTSTSTT- 3ST- 3T- 2T- 2ST- 3ST- 3ST- 3S3'7'TYPICAL CONRETETRASH PADTYPICAL CONRETETRASH PAD3'7'PLAN 1S-2S-1S-3S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-1S-3S-3S-3S-3S-3S-3S-3S-3S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-2S-1S-1S-1S-1S-1S-1S-1STT-1T-1STYPICAL CONCRETETRASH PAD3'7'PLANTING SCHEDULESHRUBSSYMBOTANICAL NAMECOMMON NAMEWUCOLSSIZESPACINGGROWTH SIZEH/WS-3COTONEASTER PARNEYIBUTTERFLY BUSHL5 GAL.8' x 10'S-3CALLIANDRA CALIFORNICABAJA FAIRY DUSTERL5 GAL.4' x 4'S-2EURYOPS PETINATUSSHRUB DAISYL5 GAL.4' x 4'S-1LAVANDULA ANGUSTIFOLIAENGLISH LAVENDERL1 GAL.4' x 3'S-2LAVANDULA DENTATAFRENCH LAVENDERL5 GAL.4' x 6'S-2SALVIA GREGGIIAUTUMN SAGEL5 GAL.4' x 4'S-3SALVIA LEUCANTHAMEXICAN BUSH SAGEL5 GAL.4' x 6'S-1SALVIA CLEVELANDIISALVIAL1 GAL.4' x 4'S-1WESTRINGIA FRUCTICOSACOAST ROSEMARYL1 GAL.3' x 3'GROUNDCOVERSGC-1LANTANA MONTEVIDENSIS (GOLD CULTIVARS)TRAILING LANTANAL1 GAL.4' 0.C.2' x 6'GC-2ROSMARINUS O. 'HUNTINGTON CARPET'HUNTINGTON CARPET ROSEMARYL1 GAL.6' O.C.2' x 8'GC-3BACCHARIS P. PILULARIS 'TWIN PEAKS'DWARF COYOTE BUSHL1 GAL.3' O.C.15" x 8'NOTE TO CONTRACTOR: IF GRAPHIC REPRESENTATION OF PLANTINGS ON PLANS DOES NOT MATCH QUANTITIES IN PLANT LIST, GRAPHICREPRESENTATION OF PLANTINGS ON PLANS WILL GOVERN.PLANTING SCHEDULETREES - THE TREE IN THE FRONT OF THE HOME SHALL BE 24" BOX . THE TREE ON THE SIDE YARD SHALL BE 15 GAL.SYMBOTANICAL NAMECOMMON NAMEWUCOLSSIZECOMMENTSGROWTH SIZEH/WT-1BRACHYCHITON POPULNEUSBOTTLE BRUSHL24" BOX40' x 30'T-1S(SIDE)PRUNUS ILICIFOLIAHOLLY-LEAFED CHERRYL15 GAL.20' x 20'T-2LAURUS NOBILIS 'SARATOGA'SWEET BAYL24" BOX30' x 30'T-2S(SIDE)LAGERSTROEMIA MUSKOGEEMUSKOGEE CRAPE MYRTLEM24" BOX20' x 15'T-3ARBUTUS UNEDOSTRAWBERRY TREEL24" BOX25' x 25'T-3S(SIDE)CERCIS OCCIDENTALISWESTERN RED BUDL15 GAL.15' x 15'VINESŸMACFADYENA UNGUIS-CATICAT'S CLAW VINEL1 GAL.MAX SPACE 15'O.C.30' LONGNOTE TO CONTRACTOR: IF GRAPHIC REPRESENTATION OF PLANTINGS ON PLANS DOES NOT MATCH QUANTITIES IN PLANT LIST, GRAPHICREPRESENTATION OF PLANTINGS ON PLANS WILL GOVERN.ST - STREET TREE PLANTING SCHEDULETREESSTREETBOTANICAL NAMECOMMON NAMEWUCOLSSIZECOMMENTSGROWTH SIZEH/WTILLER LANEARBUTUS UNEDOSTRAWBERRY TREEL24" BOXSTD30' x 30'COTTAGE LANERHUS LANCEAAFRICAN SUMACL24" BOXSTD25' x 25'VICTORIA WAYLAURUS NOBILIS 'SARATOGA'SWEET BAYL24" BOXSTD.30' x 30'ULLA LANEPRUNUS ILICIFOLIAHOLLY-LEAFED CHERRYL24" BOXSTD.20' x 20'ROOT BARRIER NOTE:ALL TREES WITHIN 8'-0" OF HARDSCAPE SHALL RECEIVE ROOT BARRIERS PRODUCT "LIB 24-2 POLYPROPYLENE, WITH 0.085" WALLS ASMANUFACTURE BY DEEPROOT COMPANY CO.345 LORTON AVE, SUITE 103 BURLINGAME, CA 92010 CITY STANDARD "608. INSTALL LINEAR ROOT BARRIERS PER CITYSTANDARDS OR BIOBARRIER.MULCH NOTE:INSTALL 3" SHREDDED BARK MULCH IN ALL SHRUB AREASMULCH NOTE:INSTALL 3" SHREDDED BARK MULCH IN ALL SHRUB AREASGROUNDCOVER LOCATIONSPLANGROUNDCOVER1GC-22GC-13GC-3SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996TYPICAL PLANPLOT DATE DECEMBER 27 20168PLANTING PLANP-1SIDEWALKROWPROPERTY LINEPROPERTY LINECURB FACESIDEWALKROWCURB FACEPROPERTY LINEPROPERTY LINEPARKWAYPARKWAYPARKWAY5 LOCATE PLANTS EQUALLY (TRIANGULAR SPACED)PER SPACING INDICATED ON PLANSSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996TYPICAL PLANPLOT DATE DECEMBER 27 201682.#06+0)&'6#+.52&Ä and groundcovers.and location of sprinkler heads.B. Water Supply:A. Physical Layout:3.2 Preparation:2. All layout shall be approved by Landscape Architect prior to installation.1. Prior to installation, the Contractor shall stake out all pressure supply lines, routing, proceed before starting work on the sprinkler irrigation system.4. The Contractor shall carefully check all grades to satisfy himself that he may safely no interference with utilities or other construction or difficulty in planting trees, shrubs, 3. Coordinate installation of sprinkler irrigation materials, including pipe so there shall be shown on drawings.C. Electrical Supply:and as noted.3.3 Installation:A. Trenching:B. Backfilling:connection as shown on the drawings.Contractor is responsible for minor changes caused by actual site conditions.2. Connections shall be made at approximate locations as shown on the drawings. 1. Electrical connections for automatic controller shall be made to electrical points of Contractor is responsible for minor changes caused by actual site conditions.2. Connections shall be made at approximate locations as shown on the drawings. 4. Provide for a minimum cover of 18-inches for all control wiring.3. Provide for a minimum cover of 12-inches for all non-pressure lines.2. Provide for a minimum cover of 18-inches for all pressure supply lines.even grade. Trenching excavation shall follow layout indicated on the drawings 1. Dig trenches straight and support pipe continuously on bottom of trench. Lay pipe to 1. Sprinkler irrigation system shall be connected to water supply points of connection as this is not possible, the side of the trench adjacent to the tree shall be kept 1. The Contractor shall flush and adjust all sprinkler heads for optimumperformance and to prevent overspray onto walks, roadways, and2. If it is determined that adjustments in the irrigation equipment willprovide proper and more adequate coverage, the Contractor mayalso include changes in nozzle sizes and degrees of arc as required.3. Lowering raised sprinkler heads by the Contract shall be accomplished within ten days after notification by Owner or Landscape Architect.4. All sprinkler heads shall be set perpendicular to finished gradeunless otherwise designated on the plan or as required for propershaded with burlap or canvas.B. Testing of Irrigation System:3.6 Field Quality Control:A. Adjustment of the System:buildings as much as possible.coverage (slopes, etc.).equal. Trenches adjacent to trees should be closed within 24-hours, and where 1. Install the sprinkler heads as designated on the drawings. Sprinkler heads to be installed in this work shall be equivalent in all respects to those 2. Spacing of sprinkler heads shall not exceed the maximum as indicatedon the drawings. In no case shall the spacing exceed the maximum3.4 Temporary Repairs: The Owner reserves the right to make temporary repairsto keep the sprinkler system equipment in operating condition. The exerciseof this right by the Owner shall not relieve the Contractor of his responsibilities under the terms of the guarantee as herein specified.3.5 Existing Trees: Where it is necessary to excavate adjacent to existing trees, the Contractor shall use all possible care to avoid injury to trees and tree roots. Excavation in areas where 2-inch and larger roots occur shall be done by hand. All roots 2-inches and larger in diameter, except directly in the path of pipe or conduit, shall be tunneled under and shall be heavily wrapped with burlap to prevent scarring or excessive drying. Where a ditching machine is run close to trees having roots smaller than 2 inches in diameter, the wall of the trench adjacent to the tree shall be hand trimmed, making clean cuts through. Roots 1/2 inch and larger in diameter shall be painted with two coats of tree seal, or recommended by the manufacturer.itemized in the irrigation equipment legend.J. Sprinkler Heads:of electric control valves or quick coupling valves.surface irregularities.compaction of the existing adjacent undisturbed soil and shall be left in a firm adjustments without cost to the Owner.3. Flooding of trenches will be permitted only with approval of the Landscape Architect.shall be carefully backfilled with the excavated materials approved for backfilling, C. Trenching and Backfill Under Paving:2. Generally, piping under existing walks is done by jacking, boring, or hydraulic driving, pressure test all piping under paving prior to the paving work.unyielding condition. The sprinkler irrigation Contractor shall set in place, cap, and mechanical tamping devices. Trenches for piping shall be compacted to equal the above the pipe), and compacted in layers to 95% compaction, using manual or installed shall be backfilled with sand (a layer six-inches below the pipe and 3-inches 1. Trenches located under areas where paving, asphaltic concrete or concrete will be planting, or other construction as necessary, the Contractor shall make all required 4. If settlement occurs and subsequent adjustments in pipe, valves, sprinkler heads, lawn, or matter larger than 1/2-inch in size will be permitted in the initial backfill.2. A fine granular material backfill will be initially placed on all lines. No foreign Backfill will conform to adjacent grades without dips, sunken areas, humps, or otherlandscaped areas to a dry density equal to adjacent undisturbed soil in planting areas. large clods of earth or stones. Backfill shall be mechanically compacted in consisting of earth, loam, sandy clay, sand or other approved materials, free from 1. The trenches shall not be backfilled until all required tests are performed. Trenches D. Assemblies:the Landscape Architect.No hydraulic driving will be permitted under new concrete paving.break sidewalks and/or concrete shall be obtained from the Landscape Architect. done and replaced by the Contractor as part of the contract cost. Permission to cut or but where any cutting or breaking of sidewalks and/or concrete is necessary it shall be 1. Routing of sprinkler irrigation lines as indicated on the drawings is diagrammatic. Install perform such work in accordance with the best standard practice with prior approval of detail drawings or specifications pertaining to specific items required to complete work, 3. Install all assemblies specified herein in accordance with respective detail. In absence of 2. Install no multiple assemblies on plastic lines. Provide each assembly with its own outlet.lines (and various assemblies) in such a manner as to conform with the details per plans. 5. On PVC to metal connections, the Contractor shall work the metal connections first. Teflon tape, or approved equal, shall be used on all threaded PVC to PVC, and on all threaded PVC to metal joints. Light wrench pressure is all that is required. Where threaded PVC connections are required, use threaded PVC E. Line Clearance: All lines shall have a minimum clearance of 6 inches from each other and from lines of other trades. Parallel lines shall not be installed directly before installation. Installation and solvent-weld methods shall be as 4. PVC pipe and fittings shall be thoroughly cleaned of dirt, dust, and moisture recommended by the pipe and fitting manufacturer.adapters into which the pipe may be welded.B. The Landscape Architect reserves the right to waive or shorten theoperation period.3.8 Clean-up: Clean-up shall be made as each portion of work progresses.Refuse and excess dirt shall be removed from the site. All walks and paving shall be broomed or washed down, and any damage sustained on the work of others shall be repaired to original conditions.3.9 Final Observation Prior to Acceptance:A. The Contractor shall operate each system in its entirety for theLandscape Architect at the time of final inspection. Any items deemednot acceptable by the qualified observer shall be reworked to thecomplete satisfaction of the Landscape Architect.B. The Contractor shall show evidence to the Landscape Architect that the Owner has received all accessories, charts, record drawings andNote: Testing of pressure main line piping shall occur prior to installation 3. All piping under paved areas shall be tested under hydrostatic pressure of 150 psi and proved watertight, prior to paving.4. Sustain pressure in tested lines for not less than two hours. If leaksdevelop, replace joints and repeat test until entire system is proven5. All hydrostatic tests shall be made only in the presence of theLandscape Architect. No pipe shall be backfilled until it has been6. Contractor shall furnish force pump & all other test equipment necessary.When the sprinkler irrigation system is completed, perform a coveragetest in the presence of the Landscape Architect to determine if the water coverage for planting areas is complete and adequate. Furnish all materials and perform all work required to correct any inadequacies of coverage due to the deviation from plans, or where the system has been willfully installed as indicated on the drawing when it is obviously inadequate, without bringing this to the attention of the Landscape Architect. This test shall be accomplished before any groundcover is 8. Upon completion of each phase of work, the entire system shall be A. The entire sprinkler irrigation system shall be under full automaticoperation for a period of seven days prior to any planting and for 90days after inspection to begin maintenance period.tested and adjusted to meet site requirements.3.7 Maintenance:prove watertight.watertight.observed, tested, and approved in writing.planted.1. The Contractor shall request the presence of the Landscape Architect2. Test all pressure lines under hydrostatic pressure of 150 PSI and in writing at least 48 hours in advance of any testing.Pre-job conference - 7 days.Final Observation - 7 days.Coverage test - 48 hours.Observation to begin maintenance period - 7 days.Lateral line and sprinkler installation - 48 hours.Control wire installation - 48 hours.Automatic controller installation - 48 hours.Pressure supply line installation and testing - 48 hours. END1.3.4.5.6.7.8.2.the Irrigation Contractor.authorities having jurisdiction.used to flush out the system.I. Flushing of System:F. Automatic Controller: Install per manufacturer's instructions. Remote control valves shall be connected to controller in numerical sequence as shown on the drawings.1. 120-volt power connection to the automatic controller shall be provided by 2. All electrical work shall conform to local codes, ordinances, and unionH. Remote Control Valves: Install where shown on the drawings and per detail. When grouped together, allow at least 12 inches between valve boxes. Install each remote control valve in a separate valve box.1. After all new sprinkler pipe lines and risers are in place and connected, all necessary diversion work has been completed, and prior to installation of sprinkler heads, the control valves shall be opened and a full head of water 2. Sprinkler heads shall be installed only after flushing of the system has been accomplished to the complete satisfaction of the Landscape Architect.G. High Voltage Wiring for Automatic Controller:A. Contractor shall be responsible for notifying the Landscape Architect in Architect at the rate per hour (portal to portal) plus transportation costs, advance for the following observations according to the time indicated:B. When observations have been conducted by other than the LandscapeArchitect, show evidence of when & by whom these observations were made.C. No observation will commence without record drawings. In the event theContractor calls for an observation without record drawings, withoutcompleting previously noted corrections, or without preparing the system for observation, he shall be responsible for reimbursing the Landscape for the inconvenience. No further observations will be scheduled until this charge has been paid.3.10 Observation Schedule:over one another.equipment as required before final observation can occur.D. Galvanized Pipe Fittings:Koppers 50 Bitumastic.screwed pipe.E. Gate Valve:bronze wheel handle.couplings may be merchant coupling.approved equal.G. Backflow Preventer Unit:construction details.Key size and type shall be as shown on plans.3. All gate valves shall be installed per installation detail.H. Check Valves:I. Control Wiring:similar to the King Bros. "CV" series or approved equal.exceed Federal Specification WW-V-51D, Class A, Type IV.been rendered.PART 1 - GENERAL CONDITIONSIRRIGATION SPECIFICATIONS1.2 Quality Assurance:1.1 Description:out by the Contractor. Anything contained in these specifications shall not be into and made a part of these specifications and their provisions shall be carried regulations governing or relating to any portion of this work are hereby incorporated B. Ordinances and Regulations: All local, municipal and state laws, and rules anddirections covering points not shown in the drawings and specifications.followed in all cases where the manufacturers of articles used in this contract furnish A. Manufacturer's Directions: Manufacturer's directions and detailed drawings shall be furnish and install irrigation systems as shown on the drawings and described herein. A. Work Included: Provide all labor, materials, transportation, and services necessary to1.6 Guarantee: C. Explanation of Drawings:authorized representative.revisions necessary.specifications and drawings shall take precedence.not performed, the irrigation contractor shall assume full responsibility for any attention of the Owner's authorized representative. In the event this notification is the irrigation design. Such obstructions or differences should be brought to the discrepancies in area dimensions exist that might not have been considered in drawings when it is obvious in the field that obstructions, grade differences, or 4. The Contractor shall not willfully install the irrigation system as shown on the installed whether or not specifically mentioned in the specifications. 3. All work called for on the drawings by notes or details shall be furnished and 2. The word Landscape Architect as used herein shall refer to the Owner'savoid conflicts between irrigation systems, planting, and architectural features.the work to be installed. The work shall be installed in such a manner as to meet such conditions. Drawings are generally diagrammatic and indicative of plan his work accordingly, furnishing such fittings, etc. as may be required to investigate the structural and finished conditions affecting all of his work and fittings, sleeves, etc., which may be required. The Contractor shall carefully 1. Due to the scale of the drawings, it is not possible to indicate all offsets, size than is required by the above rules and regulations, the provisions of thesematerials, workmanship, or construction of a better quality, higher standard, or largerthe same. However, when these specifications and drawings call for or describe construed to conflict with any of the above rules and regulations or requirements of writing to the Landscape Architect at the conclusion of the project that this service has maintenance personnel with instructions for major equipment and show evidence in 2. In addition to the above mentioned maintenance manual, provide the Owner's d. Complete operating and maintenance instructions on all major pieces of equipment.c. Guarantee statement (Section 1.05).under this contract.b. Catalog and parts sheets on every material and equipment installed with names and addresses of local manufacturer's representatives.a. Index sheets stating Contractor's address and telephone number, list of equipment the following information:completion of construction, two hard cover binders with three rings each containing 1. Prepare and deliver to the Landscape Architect within ten calendar days prior to D. Operation and Maintenance1.5 Analysis of samples and tests: None.dented or damaged will be discarded, and if installed, shall be replaced with new piping.undue bending or concentrated external load at any point. Any section of pipe that has been transported in a vehicle which allows the length of pipe to lie flat so as not to subject it to handling, loading, unloading, and storing of PVC pipe and fittings. All PVC pipe shall be A. Handling of PVC Pipe and Fittings: The Contractor is cautioned to exercise care in 1.4 Product Protection, Storage, and Handling:material must be shown to the Landscape Architect.of the project. Before final inspection can occur, evidence that the Owner has received 2. The above mentioned equipment shall be turned over to the Owner at the conclusion quick coupling valve installed.d. Six quick coupler keys and matching hose swivels for each type ofc. Two keys for each automatic controller or enclosure.b. Two five-foot valve keys for operation of gate valves (as required).adjusting each type of sprinkler and valve installed under this contract.a. Two sets of special tools required for removing, disassembling, and1. Supply as part of this contract the following tools: E. Equipment to be Furnished:wire size be less than #14.intervals of ten feet.pressure supply or lateral lines wherever possible.control wire conductors.J. Automatic Controller:permitted without prior approval of the Landscape Architect.K. Electric Control Valves:a manual flow adjustment.contractor.representative prior to installation.L. Control Valve Boxes:M. Sprinkler Heads:irrigation system.following information:PART 2 - MATERIALS A. Material List: B. Record Drawings:substituted for the materials list, and will be rejected as unacceptable.materials and equipment to be used. Copies of catalog information shall not belist shall include the manufacturer, model number, and description of all 2. Complete material list shall be submitted prior to performing any work. Material allowed without prior written approval by the Landscape Architect.specified by name in the drawings and specifications. No substitution will be 1. The Contractor shall furnish the articles, equipment, materials, or processeson the basis of the information or samples submitted.blue line ozalid prints which shall be corrected daily and show every change 1. The Contractor shall provide and keep up to date a complete "record" set of under the guarantee. Such warranties shall only supplement the guarantee.5. Manufacturer's warranties shall not relieve the Contractor of his liabilityproduct apparently the requirements of the drawings and specifications4. Approval of any item, alternate, or substitute indicated only that thesuch materials from the site at his own expense.Landscape Architect may be rejected and the Contractor required to remove 3. Equipment or materials installed or furnished without prior approval of the c. Schedule or classb. Nominal pipe sizethe Landscape Architect. f. Routing of control and common wire d. Routing of pressure main line pipe a. Connection to existing water lines g. Quick coupling valves e. Sprinkler control valves c. Gate valveslocation of the following items: b. Connections to existing electrical power 5. On or before the date of the final inspection, the Contractor shall deliver the h. Other related equipment as directed by the Landscape Architect. 4. The Contractor shall dimension from two permanent points of reference thedevices. All work shall be subject to approval by the Landscape Architect.ball point pen will be rejected because of the non-permanent nature of both designed specifically for use on mylar material. Work completed in felt tip pen or Architect. All work shall be neat, drawn in waterproof ink by a technical ink pen from the record prints to a sepia mylar or mylar procured from the Landscape 3. Before the date of the final inspection, the Contractor shall transfer all information available at all times for inspection and shall be kept in a location designated by proceeds, showing the work as actually installed. These drawings shall be 2. The Contractor shall make neat and legible annotations thereon daily as the work of drawings shall be kept on the site and shall be used only as a record set.shall be the basis for measurement and payment for work completed. This set kinds of equipment. These drawings shall also serve as work progress sheets and from the original drawings and specifications and the exact locations, sizes, and specifications shall be filed with the Owner or his representative prior to acceptance of the attached form. The general conditions and supplementary conditions of theseC. The guarantee form shall be re-typed onto the Contractor's letterhead and contain the manual (Section 1.03, D).B. A copy of the guarantee form shall be included in the operations and maintenance and telephone number of Irrigation Contractor, in addition to the date of acceptance).(The above statement is to be followed by the project name, location, signature, address, made at our expense and we will pay the costs and charges therefore upon demand.from the Owner, we authorize the Owner to proceed to have said repairs or replacements make such repairs or replacements within a reasonable time after receipt of written notice reasonable time after receipt of written notice from the Owner. In the event of our failure to defects at no additional cost to the Owner. We shall make repairs or replacements within a and also to repair or replace any damage resulting from the repairing or replacing of such workmanship which may develop during the period of one year from the date of acceptance the drawings and specifications. We agree to repair or replace any defects in material or defects in materials and workmanship, and the work has been completed in accordance with We hereby guarantee that the sprinkler system we have furnished and installed is free from GUARANTEE FOR SPRINKLER IRRIGATION SYSTEMinstallation methods prescribed by the manufacturer.6. Solvent cement and primer for PVC solvent-weld pipe and fittings shall be of the type and ASTM test procedure D2466.5. PVC solvent-weld fittings shall be Schedule 40, 1-2, 11-1 NSF approved conforming to Federal Specification PS-21-70 (Solvent-Weld Pipe).ASTM resin specification D1785. All pipe must meet requirements as set forth in 4. Pipe shall be made from NSF approved Type 1, Grade 1, PVC compound conforming to with solvent welded joints.3. Pressure main line piping for sizes 1 and 1/2 inch and smaller shall be PVC Schedule 40 Specification PS-22-70 (Solvent Weld Pipe) with an appropriate standard dimension (S.D.R.)to ASTM resin specification D1784. All pipe must meet requirements as set forth in Federal 2. Pipe shall be made from an NSF approved Type 1, Grade 1, PVC compound conforming 1. Pressure main line piping for sizes 2-inches and larger shall be PVC Class 315.A. PVC pressure Main Line Pipe and Fittings:specified herein, or approved equals.2.1 General: Use only new materials of brands and types noted on the drawings,a. Manufacturer's name7. All PVC pipe must bear the following markings:sprinkler body.PART 3 - EXECUTIONconstruction details shown on the drawings.2. All spray type sprinklers shall have a screw adjustment.on the drawings and/or specified in these special provisions.under this section.A. Site Conditions:3.1 Inspection:f. Date of extrusionauthorized representative.charts are prepared.C. Controller Charts:process. the plasstic laminating shaeets shall be a minimum of 10 mil. thickness each.6. When completed and approved, the chart shall be sealed by a plastic laminating be used to indicate the area of coverage for each control valve station.5. The chart shall be a bloacline or blueline ozalid print and a different color shall shall be readable when the controller chart is completed.the event the controller sequence is not legible when the drawing is reduced, it 4. The chart is to be a reduced drawing of the actual record drawings. However, in 2. Provide one controller chart for each controller supplied.sized as designated by each automatic controller or as designated by the Owner's 3. The chart shall show the area controlled by each automatic controller and shall be 1. Record drawings shall be approved by the Landscape Architect before controller information that may be omitted from the prints he compiled at the site.mylars will not relieve the Contractor of the responsibility of furnishing requirede. NSF (National Sanitation Foundation) approval2. Fittings shall be red brass conforming to Federal Specification WW-P-460.Specification WW-P-351.1. Where indicated on the drawings, use red brass screwed pipe conforming to Federal C. Brass Pipe and Fittings:pipe and fittings as set forth in Section 2.01B of these specifications.lateral line pipe and fittings shall be the same as for solvent-weld pressure main line 3. Except as noted in paragraphs 1 of 2 of Section 2.01C, all requirements for non-pressureSpecifications PS-22-70 with an appropriate standard dimension ratio.ASTM resin specification D1784. All pipe must meet requirements set forth in Federal 2. Pipe shall be made from NSF approved, Type 1, Grade II, PVC compound conforming to 1. Non-pressure buried lateral line piping shall be PVC sch40 with solvent-weld joints.B. PVC Non-Pressure Lateral Line Piping:applicable I.P.S. schedule and NSF seal of approval.8. All fittings shall bear the manufacturer's name or trademark, material designation, size, corrected and completed mylars to the Landscape Architect. Delivery of the d. Pressure rating in PSI1.3 Submittals:A. The guarantee for the sprinkler irrigation system shall be made in accordance with the 4. Riser nipples for all sprinkler heads shall be the same size as the riser opening in the Check existing utilities drawings or call utilities companies for existing utility locations.be responsible for damages to utilities which are caused by his operations or neglect. 2. Exercise extreme care in excavating and working near existing utilities. Contractor shall dimensions and receive Landscape Architect's approval prior to proceeding with work 1. All scaled dimensions are approximate. The Contractor shall check and verify all site with the diameter (or radius) of spray, pressure, and discharge in G.P.M. as shown 3. Riser/swing joint assemblies shall be fabricated in accordance with the irrigation 1. All sprinkler heads shall be of the size, type, and deliver the same rate of precipitation Industries 1419-12B with green bolt down cover or approved equal.2. Use 9-1/2" x 16" x 11" rectangular box for all electric control valves, Carsoncontroller to the 120-volt power source shall be the responsibility of the irrigationcontroller location shall be furnished by others. The final hook-up of the automatic 3. Unless otherwise noted on the plans, the 120-volt electrical power to the automatic 2. Final location of automatic controller shall be approved by the Owner's authorized 1. Automatic controller shall be of size and type shown on the drawings.6. Field splices between the automatic controller and electric control valves will not be sealer or approved equal. Use one wire connector per wire splice.5. All splices shall be made with Rainbird ST-03UL Snap-Tite wire connector with PT/S5 control wires. Control wires shall be laid loosely in trench without stress or stretching of repair, the valve bonnet may be brought to the surface without disconnection of the sufficient length at each splice connection at each electric control valve so that in case of 4. An expansion curl shall be provided at each wire connection. Expansion curl shall be of 3. Where more than one wire is placed in a trench, the wiring shall be taped together at 2. Wiring shall occupy the same trench and shall be installed along the same route as accordance with valve manufacturer's specifications and wire chart. In no case shall different colors for each controller installed on the same project. Install wire instripe to match the pilot wires with which it is circuited on the same controller. Provide automatic controller shall be the same color. Common wire shall be white in color with a made with direct burial copper wire AWG-U.F. 600 volt. Pilot wires sharing the same 1. Connections between the automatic controllers and the electric control valves shall be bolt down cover or approved equal. Extension sleeve shall be PVC-6-inch minimum size.1. Use 10" x 10 1/4" round box for all gate valves, Carson Industries 910-12B with green 3. Provide and install one control valve box for each electric control valve.2. Unless otherwise noted on plan or construction details, all electric control valves shall have 1. Electric control valves shall be of the size and type shown on the drawings.field adjustable against drawout from 3 to 40 feet of head. Anti-drain valve shall be and outlet. Internal parts shall be stainless steel with Buna-N seals. Valve shall be 2. Anti-drain valves shall be of heavy-duty virgin PVC construction with F.I.P. thread inlet drawings. Install the backflow prevention units in accordance with the irrigation 1. Backflow prevention units shall be of size and type indicated on the irrigation 100 mesh monel screen and shall be similar to Bailey 100A or approved equal.2. Wye strainers at backflow prevention units shall have a bronzed screwed body with construction and replaceable composition, neoprene or rubber disc, and shall meet or 1. Swing check valves 2-inches and smaller shall be 200 lbs. WOG bronze bronze designed for working pressure of 150 PSI operable with quick coupler key. F. Quick Coupling Valves: Quick coupling valves shall have a brass two-piece body 2. Gate valves 3-inches and smaller shall be similar to those manufactured by Nibco or bonnet, non-rising stem and solid wedge disc, have threaded ends, and be equipped with 1. Gate valves 3-inches and smaller shall be 125-lb. SWP bronze gate valve with screw-in 3. All galvanized pipe and fittings installed below grade shall be painted with two coats of 2. Fittings shall be medium galvanized screwed beaded malleable iron. Galvanized 1. Where indicated on the drawings, use galvanized steel pipe ASA Schedule 40 mild steel SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996TYPICAL PLANPLOT DATE DECEMBER 27 201685+Ä+44+)#6+1052'%+(+%#6+105 SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996TYPICAL PLANPLOT DATE DECEMBER 27 201682.#06+0)52'%+(+%#6+10552ÄRJQURJCVGUCPFUJCNNEQPVCKPOKPKOWOWPCEEGRVCDNGEQPFKVKQPU(+0'(+0+5*)4#&+0)ECWUGYGGFUGGFUVQURTQWV51+.%10&+6+10+0)QHVJGUK\GPQVGFQPFTCYKPIU#'XGPN[FKUVTKDWVGUQKNEQPFKVKQPGTRGTTGEQOOGPFCVKQPUHTQOUQKNUTGRQTVCPFVJQTQWIJN[KPEQTRQTCVGKPVQVJGVQRQHUQKNYKVJC&4GOQXGCNNHQTGKIPOCVGTKCNUTGOQXGENQFUCPFTQEMUNCTIGTVJCPÄKPCP[FKOGPUKQPHTQOUQKNYKVJKPKPEJGUQHHKPKUJITCFG'$TKPIHKPKUJITCFGUVQTGSWKTGGNGXCVKQPUUQVJCVCHVGTEQPFKVKQPKPICPFRNCPVKPIITCFGKUÄDGNQYVQRUQHEWTDUCPFYCNMU5NQRGVQFTCKPVQYCTFCFLCEGPVFTCKPCIGUYCNGUQTECVEJDCUKPU#%QPVTCEVQTUJCNNIGTOKPCVGCPFFGUVTQ[GZKUVKPIYGGFUGGFUDGHQTGRTGRCTKPICTGCUHQTRNCPVKPI5WHHKEKGPVYCVGTUJCNNDGCRRNKGFVQ$7UGQHRTGÄGOGTIGFU[UVGOKEJGTDKEKFGRGTOCPWHCEVWTGTžUKPUVTWEVKQPKURGTOKVVGFRGT.CPFUECRG#TEJKVGEVžUCRRTQXCN('46+.+<'451+.#/'0&/'065#0&%10&+6+10'45#5QKN#OGPFOGPV5JCNNDGPKVTQIGPHQTVKHKGFTGFYQQFEGFCTQTHKTUJCXKPIUOCPWTGRKPGQTQVJGTOCVGTKCNYKNNPQVDGCEEGRVGF5WDOKVUCORNGCPFPWVTKGPVCPCN[UKUCVNGCUVUGXGP  FC[URTKQTVQWUG$%QOOGTEKCNHGTVKNK\GT1TICPKEHGTVKNK\GTHQTOWNCVGFYKVJWPKHQTOKPEQORQUKVKQPFT[CPFHTGGHNQYKPI2TQXKFGHGTVKNK\GTEQPVGPV%#ITKEWNVWTCNI[RUWO5VCPFCTFEQOOGTEKCNSWCNKV[OCPWHCEVWTGFHQTWUGCUCUQKNCOGPFOGPVCUCRRTQXGFD[.CPFUECRG#TEJKVGEVCPFRGTUQKNUTGRQTV(QTDKFFKPIRWTRQUGUQPN[WUG  NDUUH&5QKNUWNHWT5VCPFCTFEQOOGTEKCNSWCNKV[OCPWHCEVWTGFHQTWUGCUCUQKNCOGPFOGPVCUCRRTQXGFD[.CPFUECRG#TEJKVGEVCPFRGTUQKNUTGRQTV(QTDKFFKPIRWTRQUGUQPN[WUGQPG  NDUH/+5%'..#0'175/#6'4+#.5#6TGGUVCMGU.QFIGRQNGRKPGRQKPVGFQPQPGGPF5VCKPGPVKTGNGPIVJYKVJITGGPUJKPINGUVCKP2TQXKFGKPFKCOGVGTD[HVNQPIUVCMGU$6TGGVKGUž%KPEJÄVKGQTCRRTQXGFGSWCN%*GTDKEKFGU%QOOGTEKCNSWCNKV[RTGÄGOGTIGPVV[RGCUCRRTQXGFD[CNKEGPUGFRGUVEQPVTQNCFXKUGTCPF.CPFUECRG#TEJKVGEVHQTWUGYKVJ*GTDKEKFGUJCNNGHHGEVKXGN[EQPVTQNCNNDTQCFNGCHITQWPFEQXGTITQYVJHQTCRGTKQFQHPQVNGUUVJCPOQPVJU&/WNEJ-GNNQIžU(KT$CTM Ä 24'Ä+052'%6+10 $[%QPVTCEVQT #'ZCOKPGUKVGHQTEQPFKVKQPUVJCVYKNNCFXGTUGN[CHHGEVGZGEWVKQPRGTHQTOCPEGCPFSWCNKV[QHYQTM$+OOGFKCVGN[PQVKH[VJG.CPFUECRG#TEJKVGEVKPYTKVKPIFGUETKDKPICP[##NNHNQYNKPGUUJCNNDGOCKPVCKPGFVQCNNQYHTGGFTCKPCIGQHUWTHCEGYCVGT&KURNCEGFOCVGTKCNYJKEJKPVGTHGTGUYKVJFTCKPCIGUJCNNDGTGOQXGFCPFRNCEGFCUFKTGEVGF.QYURQVUUJCNNDGTGOQXGFCPFRNCEGFCUFKTGEVGF.QYURQVUUJCNNDGITCFGFVQFTCKPRTQRGTN[$#NNTQEMFGDTKUCPFOKUEGNNCPGQWUHQTGKIPOCVVGTUJCNNDGTGOQXGF%(KPKUJITCFGCNNRNCPVKPICTGCUVQCUOQQVJGXGPEQPFKVKQP/CMGUWTGVJCVPQYCVGTRQEMGVUQTKTTGIWNCTKVKGUTGOCKPURGEKGUQHRNCPVUURGEKHKGFQP2NCPVKPI2NCPU#2NCPVUUJCNNDGRNCPVGFYJGTGUJQYPQPRNCPUCPFCUFKTGEVGFD[VJG$0QRNCPVUUJCNNDGVTCPURQTVGFVQVJGRNCPVKPICTGCVJCVCTGPQVVJQTQWIJN[OQKUVVJTQWIJQWVVJGDCNNQHGCTVJUWTTQWPFKPIVJGTQQVU2NCPVUUJQWNFPQVDGCNNQYGFVQFT[QWVPQTUJCNNCP[TQQVUDGGZRQUGFVQVJGCKTGZEGRVFWTKPIVJGCEVQHRNCEGOGPV#P[RNCPVUVJCVKPVJGQRKPKQPQHVJG.CPFUECRG#TEJKVGEVCTGFT[QTKPCYKNVGFEQPFKVKQPYJGPFGNKXGTGFQTVJGTGCHVGTYJGVJGTKPRNCEGQTPQVYKNNPQVDGCEEGRVGFCPFUJCNNDGTGRNCEGFCVVJG%QPVTCEVQTžUGZRGPUG%2NCPVRKVUHQTEQPVCKPGTRNCPVUUJCNNJCXGXGTVKECNUKFGUCPFUJCNNDG&$CEMHKNNOKZUJCNNDGFGVGTOKPGFD[UQKNVGUVCUURGEKHKGFCDQXG(QTDKFRWTRQUGUQPN[DCEMHKNNOCVGTKCNHQTRNCPVRKVUUJCNNDG#RRTQXGFUQKNRCTVUD[XQNWOGPCVKXGUQKN1TICPKECOGPFOGPVRCTVUD[XQNWOG%QOOGTEKCNHGTVKNK\GTNDRGTEW[CTF5QKNUWNHWTNDURGTEW[CTF'$CEMHKNNHQTUJCFGRNCPVUUJCNNDGQPGRCTVRTGRCTGFDCEMHKNNOKZRGTPQVGž&žCDQXGCPFRCTVUUCVWTCVGFEQCTUGRGCVOQUU(6JGDCEMHKNNOCVGTKCNUUJCNNDGVJQTQWIJN[OKZGFVQVJGDQVVQOQHVJGRKVUQVJCVVJG[CTGGXGPN[FKUVTKDWVGFCPFYKVJQWVENQFUQTNWORU)$CEMHKNNUJCNNDGUQRNCEGFKPVJGRKVUVJCVVJGRNCPVYKNNDGCVKVUPCVWTCNITQYKPIJGKIJVCPFVJGDCEMHKNNOCVGTKCNYKNNDGNGXGNKPEJDGNQYUWTTQWPFKPIUQKNITCFGCHVGTUGVVNGOGPV*(QTOUJCNNQYDCUKPCTQWPFGFIGQHRNCPVRKV+)TCFGCTGCTQWPFRNCPVVQHKPKUJITCFGOGEJCPKECNVKNNGT(QTDKFFKPIRWTRQUGUQPN[WUG5QKNCOGPFOGPV[CTFURGTUSHV(GTVKNK\GTNDURGTUSHV#ITKEWNVWTCN)[RUWONDURGTUSHV2TQVGEVVJGKPUVCNNGFYQTMCPFOCVGTKCNUQHQVJGTVTCFGUCRRTQXCNRTKQTVQFGNKXGT[VQUKVG2.#06/#6'4+#.5TGRNCEGFYKVJUWKVCDNGRNCPVU2TQVGEVOCVGTKCNUDGHQTGFWTKPICPFCHVGTKPUVCNNCVKQP#+ORQTVVQRUQKNUJCNNDGWPKHQTOKPEQORQUKVKQPHTKCDNGUCPF[NQQOHTGGQHTQQVUENQFUUVQPGU QPGKPEJQTNCTIGT PQZKQWUYGGFUQTUVKEMU+VUJCNNPQVDGKPHGUVGFYKVJPGOCVQFGUQTQVJGTRGUVUQTFKUGCUGQTICPKUOU$5WDOKVVQRUQKNUCORNGNQECVKQPQHUQWTEGCPFVGUVUQKNHQTPWVTKGPVURJUQKNVGZVWTGCPFUCNVUCVNGCUVFC[UDGHQTGUEJGFWNGWUG%6QRUQKNUCORNGOWUVTGEGKXGNCDQTCVQT[CPF.CPFUECRG#TEJKVGEVžU##NNRNCPVUUJCNNDGYGNNHQTOGFXKIQTQWUVTWGV[RGCPFHTGGHTQOFKUGCUGKPUGEVUCPFFGHGEVUUWEJCUMPQVUUWPUEQNFYKPFDWTPCDTCUKQPQTFKUHKIWTGOGPV#NNRNCPVUUJCNNJCXGXKIQTQWUCPFHKDTQWUTQQVU[UVGOUYJKEJCTGPGKVJGTTQQVDQWPFQTRQVDQWPFCPFCTGHTGGQHMKPMGFQTIKTFNGF$2NCPVUUJCNNDGVCIIGFCVPWTUGT[D[VJG.CPFUECRG#TEJKVGEVRTKQTVQFGNKXGT[VQUKVGCPFKPURGEVGFWRQPCTTKXCNVQVJGUKVG2NCPVUPQVCRRTQXGFD[VJG.CPFUECRG#TEJKVGEVUJNNDGTGOQXGFHTQOVJGUKVGKOOGFKCVGN[CPFVJG.CPFUECRG#TEJKVGEVHQTCRRTQXCNCPFCOGPFOGPVUCPFDCEMHKNNTGEQOOGPFCVKQPUUJCNNDGUGPVFKTGEVN[VQVGUVUQKNPWVTKGPVU2JUQKNVGZVWTGCPFUCNVU#EQR[QHVJGVGUVTGUWNVUÄFGGRCPFUWDOKVVJGUGVQCNQECNUQKNVGUVKPINCDQTCVQT[.CDUJCNN#6JG%QPVTCEQVUJCNNVCMGVYQGZKUVKPIUQKNUCORNGUHTQOFKHHGTGPVCTGCU51+.6'565TQQVU2#46Ä/#6'4+#.5+/214651+..CPFUECRG#TEJKVGEV2.#06+0)#(KPG(KPKUJ)TCFKPI5%12'1(914-UVCTVKPICP[CP[YQTMQHVJKUUGEVKQP241&7%6*#0&'.+0).CPFUECRG#TEJKVGEVHQTEQPUKFGTCVKQP5VQTGCNNOCVGTKCNUKPCPQTFGTN[OCPPGTCPFNQECVGUQCUVQCXQKF5GEWTG1YPGTžURGTOKUUKQPVQUVQTGRNCPVOCVGTKCNUQPVJGRTQLGEVCPCN[UKUCPF/CPWHCEVWTGTžUPCOGCPFDTCPFOCPWHCEVWTGTžUQTKIKPCNWPQRGPGFEQPVCKPGTUENGCTN[NCDGNGFYKVJYGKIJV#&GNKXGT[&GNKXGTCNNHGTVKNK\GTUQKNCOGPFOGPVCPFJGTDKEKFGUKPUWDOKVCRTQRQUCNVQRTQXKFGVJGPGCTGUVGSWKXCNGPVUK\GQTXCTKGV[VQVJG$+HCURGEKHKGFRNCPVURGEKGUQTXCTKGV[KUPQVQDVCKPCDNG%QPVTCEVQTOC[#5WDUVKVWVKQPUYKNNPQVDGRGTOKVVGFYKVJQWVYTKVVGPCRRTQXCND[.CPFUECRG#6JGKTTKICVKQPU[UVGOUJCNNDGKPUVCNNGFCFLWUVGFCPFCRRTQXGFDGHQTG(5KZV[&C[  2NCPV'UVCDNKUJOGPVCPF/CKPVGPCPEG2GTKQF&(WTPKUJKPICPF2NCPVKPI8KPGU6TGGUCPF)TQWPFEQXGTYKVJCRRTQXGFEQXGTCIG5VQGTHGTVKNK\GTCDQXGITQWPFCPFRTQVGEVHTQOOQKUVWTGCDUQTRVKQPRTKQTVQRNCPVKPI/CKPVCKPYCVGTKPIQHRNCPVUQPCTGIWNCTUEJGFWNG2TQVGEVCNNRNCPVUHTQOFCOCIGD[UWPYKPFCPFTCKPCVCNNVKOGUKPVGTHGTKPIYKVJQVJGTEQPUVTWEVKQPCEVKXKVKGU%2TQVGEVKQPUKVG$5VQTCIG57$56+676+105#TEJKVGEV'6TGGUVCMKPI%5QKN2TGRCTCVKQP$5QKN(GTVKNKV[6GUVU#22418#.52#46Ä)'0'4#.9''&%10641.2#46':'%76+10PKVTQIGPRGTUQKNUTGRQTVCTGCUJKUYQTM4GOQXGCNNVCIUNCDGNUPWTUGT[UVCMGUCPFVKGUHTQOVJG##YTKVVGPPQVKEGTGSWGUVKPICPKPURGEVKQPUJQWNFDGUWDOKVVGFVQVJG3WCPVKV[QHUQKNCOOGPFOGPVU3WCPVKV[QHJ[FTQOWNEJOCVGTKCNU3WCPVKV[QHCITKEWNVWTCNI[RUWO3WCPVKV[QHEQOOGTEKCNHGTVKNK\GTWUGF#VEQORNGVKQPQHVJGOCKPVGPCPEGRGTKQFCPFCNNGZEGUUOCVGTKCNCPFFGDTKUTGOQXGF.CPFUECRG#TEJKVGEVWRQPFGNKXGT[VQVJGLQDUKVGKPENWFG#9TKVVGPEGTVKHKECVKQPUTGSWKTGFYJKEJCTGVQDGUWDOKVVGFVQVJG'0&1(5'%6+10KPURGEVKQPCPFCRRTQXCNQHCNNNCPFUECRGEQPUVTWEVKQPKVGOURGTKQFVJG%QPVTCEVQTYKNNDGTGSWKTGFVQJCXGCEQORNGVGRTKQTVQVJGUVCTVQHVJGECNGPFCTFC[RTQLGEVOCKPVGPCPEG#VVJGGPFQHVJGECNGPFCTFC[GUVCDNKUJOGPVRGTKQFCPFFCVG2TKQTVQVJKUKPURGEVKQPVJGUKVGOWUVDGVJQTQWIJN[ENGCPGFWR$6JGHQNNQYKPIOCKPVGPCPEGKPURGEVKQPUCTGTGSWKTGF.CPFUECRG#TEJKVGEVCVNGCUVHKXG  FC[URTKQTVQVJGCPVKEKRCVGF&2TQLGEVOCKPVGPCPEGYQTMUJCNNEQPUKUVQHCRRN[KPIYCVGTYGGFKPIECTKPIHQTRNCPVUUYGGRKPIYCNMUNKVVGTRKEMÄWRCPFRGTHQTOKPICNNIGPGTCNRTQLGEVOCKPVGPCPEGRNCPVU#NNRCXGFCTGCUUJCNNDGUYGRVENGCPCPFVJGUKVGNGHVKPCPGCVCPFCEEGRVCDNGEQPFKVKQPCUCRRTQXGFD[VJG.CPFUECRGVJG.CPFUECRG#TEJKVGEV#%QPVTCEVQTUJCNNIWCTCPVGGCNNRNCPVUICNNQPCPFNCTIGTHQTCRGTKQFQHQPG[GCT#NNQVJGTRNCPVUUJCNNDGSWCTCPVGGFHQTCRGTKQFQHFC[U2NCPVUYJKEJFKGQTNQUGOQTGVJCPNGCXGUFWTKPIVJKURGTKQFUJCNNDGTGRNCEGF4GRNCEGOGPVUUJCNNDGOCFGYKVJKPFC[UQHYTKVVGPPQVKHKECVKQPVQ%QPVTCEVQT##P[GZVTCUQTTGXKUKQPUVQVJGRNCPUCTGVQDGCRRTQXGFKPYTKVKPID[##YTKVVGPPQVKEGTGSWGUVKPICPKPURGEVKQPUJQWNFDGUWDOKVVGFVQVJG.CPFUECRG#TEJKVGEVCVNGCUVFC[URTKQTVQVJGCPVKEKRCVGFFCVG2TKQTVQVJKUKPURGEVKQPVJGUKVGOWUVDGVJQTQWIJN[ENGCPGFWRCPFCNNGZEGUUOCVGTKCNCPFFGDTKUTGOQXGF6JGHQNNQYKPIKPURGEVKQPUUJCNNDGRGTHQTOGFD[VJG.CPFUECRG#TEJKVGEV#VEQORNGVKQPQHUQKNRTGRCTCVKQPCPFHKPKUJITCFKPI2NCPVOCVGTKCNUCHVGTFGNKXGT[VQUKVGDWVRTKQTVQRNCPVKPI2NCPVNQECVKQPURTKQTVQRNCPVKPI(KPCNEQPUVTWEVKQPKPURGEVKQPRTKQTVQOCKPVGPCPEG(KPCNCEEGRVCPEGCVVJGGPFQHOCKPVGPCPEGRGTKQF$6JGRNCPVGUVCDNKUJOGPVRGTKQFEQOOGPEGUYJGPCNNRNCPVU241,'%6/#+06'0#0%'#2TQLGEVOCKPVGPCPEGEQPUKUVUQHCOKPKOWOÄFC[RNCPVGUVCDNKUJOGPVRGTKQFCPFCÄFC[OCKPVGPCPEGRGTKQF%2TQLGEVOCKPVGPCPEGYQTMUJCNNEQOOGPEGCHVGTVJG.CPFUECRG#TEJKVGEVJCUCRRTQXGFRNCPVGUVCDNKUJOGPVCPFEQPVKPWGHQTCPJCXGDGGPRNCPVGFCFFKVKQPCNFC[U':64#5+052'%6+105)7#4#06''5#TEJKVGEV%'46+(+%#6+103WCPVKV[QHUGGF3WCPVKV[QHKTQPUWNHCVG#VVJECNGPFCTFC[3WCPVKV[QHUQKNUWNHWT+052'%6+105YTKVKPID[VJG.CPFUECRG#TEJKVGEVVJG[YKNNDGCSGSWCVGN[YCVGTGFCVCNNVKOGUCUTGSWKTGFVQOCKPVCKPJGCNVJ[XKIQTQWUITQYVJCVVJGTCVG+OOGFKCVGN[RTKQTVQGPFQHOCKPVGPCPEGRGTKQFTGEQOOGPFGFD[VJGUQKNUTGRQTVCVVJGHQNNQYKPIRGTKQFU)#P[FCOCIGVQRNCPVKPICTGCUUJCNNDGTGRCKTGFKOOGFKCVGN[,+PQTFGTVQECTT[QWVVJGRTQLGEVOCKPVGPCPEGYQTMVJG%QPVTCEVQTECNGPFCTFC[UHQNNQYKPIDGIKPPKPIFCVGQHOCKPVGPCPEGECNGPFCTFC[UHQNNQYKPIDGIKPPKPIFCVGQHVJGOCKPVGPCPEG+6JG%QPVTCEVQTUJCNNRTQXKFGVJTGGUWRRNGOGPVCNHGGFKPIUQHHGTVKNK\GT*%QPVTCEVQTUJCNNEQPVKPWGVQRKEMWRTQEMUVJCVUWTHCEGCPFCTGQTRNCPVGFQPVJGYKPFYCTFCPFQTUWPP[UKFGUQVJCVQHKPCRTQRGTOCPPGT2TQXKFGURGEKCNCVVGPVKQPHQTYCVGTKPIUNQRGU,QJPUQPITCUUCPF$TCOWFCITCUUUJCNNDGTGOQXGFCPFFKURQUGFHTGGCVCNNVKOGU9GGFUCPFPQZKQWUITCUUGUUWEJCU&CNNCUCPF(#NNRNCPVUCPFRNCPVGFCTGCUUJCNNDGMGRVYGNNYCVGTGFCPFYGGFCTGCHQTCPCFFKVKQPCNFC[UCVPQCFFKVKQPCNEQUVVQVJG1YPGTEQPFKVKQPUCTGPQVEQORNKGFYKVJVJG%QPVTCEVQTUJCNNTGRNCPVVJGCPFUJCNNKOOGFKCVGN[CRRN[TGOGFKGU+HVJGCDQXGCPFHQNNQYKPIOCPKHGUVGF*GUJCNNVCMGKOOGFKCVGCEVKQPVQKFGPVKH[VJGRTQDNGOFGHKEKGPEKGUFKUGCUGUCPFRGUVUCUUQQPCUVJGKTRTGUGPEGKU'6JG%QPVTCEVQTUJCNNDGTGURQPUKDNGHQTFGVGEVKPIPWVTKGPVUJCNNOCKPVCKPCUWHHKEKGPVPWODGTQHOGPCPFCFGSWCVGGSWKROGPVVQQHVJGRTQLGEVOCKPVGPCPEGRGTKQFQTWPVKNVJGHKPCNCRRTQXCNUCVKUHCEVQT[EQORNGVGCPFVJGRTQLGEVOCKPVGPCPEGKUCEEGRVGFKPKPVJGUGRTQXKUKQPUYJGPVJGRTQLGEVOCKPVGPCPEGYQTMJCUDGGP-6JG%QPVTCEVQTOC[DGTGNKGXGFHTQOVJGOCKPVGPCPEGYQTMTGSWKTGFWPVKNVJGGPFQHVJGRTQLGEVOCKPVGPCPEGRGTKQFQTWPVKNVJGGPFQHVJGRGTHQTOVJGYQTMJGTGKPURGEKHKGFHTQOVJGVKOGCP[RNCPVKPIKUFQPGTGRNCEGFKPMKPFCVVJGGZRGPUGQHVJG%QPVTCEVQTHKNNKPIYKVJVQRUQKNCPFNGXGNKPI4GÄUGGFFCOCIGFQPGVQNCYPVJGOWPUWKVCDNGHQTVJGRWTRQUGKPVGPFGFUJCNNDGKOOGFKCVGN[$'ZVGTOKPCVGIQRJGTUCPFOQNGUD[VTCRRKPICPFTGRCKTFCOCIGD[QHVJGEQPVTCEVQTVJQUGRNCPVUUQKPLWTGFQTFCOCIGFCUVQTGPFGT##NNRNCPVUVJCVUJQYUKIPUQHHCKNWTGVQITQYCVCP[VKOGFWTKPIVJGNKHG#+OOGFKCVGN[CHVGTRNCPVKPICRRN[YCVGTVQGCEJRNCPVD[OGCPUQHCJQUG#RRN[YCVGTKPCOQFGTCVGUVTGCOKPVJGRNCPVKPIJQNGWPVKNVJGOCVGTKCNCDQWVVJGTQQVUKUEQORNGVGN[UCVWTCVGFHTQOVJGDQVVQOQHVJGJQNGVQVJGVQRQHVJGITQWPF#2TWPGQPN[CUPGEGUUCT[VQTGOQXGKPLWTGFVYKIUCPFDTCPEJGU$2TWPGRNCPVUKPCEEQTFCPEGYKVJUVCPFCTFJQTVKEWNVWTCNRTCEVKEG2TWPKPIUJCNNDGRGTHQTOGFD[SWCNKHKGFCTDQTKUV%5GCNCNNEWVUKPKPFKCOGVGTQTNCTIGTYKVJCUCRRNKECVKQPQH#7RQPEQORNGVKQPQHCNNRNCPVKPIYQTMCPFDGHQTGCEEGRVCPEG%QPVTCEVQTUJCNNTGOQXGCNNOCVGTKCNCPFFGDTKUTGUWNVKPIHTQO6TGG5GCNQTGSWCN%QNQTQHUGCNCPVVQOCVEJVTWPM&QPQVWU2470+0)FGCFYQQFCPFUWEMGTUNGCFDCUGFRCKPVU%.'#0729#6'4+0)4'2.#%'/'061(2.#065RGTKQFRGTKQFITGCVGTKPFKCOGVGTCXCKNCDNG*WOKECEKF(GTVKNK\GTVQDGCXCKNCDNGPKVTQIGP/CVGTKCNEQPVCKPKPI2QVCUJRNCPVOCVGTKCNWPVKNKVJCUDGGPTGÄGUVCDNKUJGFCPFUJCNNOCKPVKCP,8KPG#PEJQTÄ6WOCZ2NCPV#PEJQTU#XCKNCDNGHTQO6WOCZÄÄ GAZEBO1/2 BASKETBALL COURTTOT LOTST - STREET TREE PLANTING SCHEDULETREESSTREETBOTANICAL NAMECOMMON NAMEWUCOLSSIZECOMMENTSGROWTH SIZEH/WTILLER LANEPINUS ELDARICAMONDELL PINEPLATANUS ACERIFOLIA'BLOODGOOD'LONDON PLANECOTTAGE LANELAGERSTROEMIA INDICACRAPE MYRTLEPINUS ELDARICAMONDELL PINEINTERNAL PRIVATE ROADSJACARANDA MIMOSIFOLIAJACARANDALAGERSTROEMIA INDICACRAPE MYRTLEMAGNOLIA GRANDIFLORA 'RUSSET'SOUTHERN MAGNOLIAQUERCUS ILEXHOLLY OAKSCHINUS MOLLECALIFORNIA PEPPER TREEULMUS PARVIFOLIA 'TRUE GREEN'EVERGREEN ELMNEIGHBORHOOD PARKCHITALPA TASHKENTENSIS'PINK DAWN'CHITALPACITRUS SPECIESCITRUS TREECUPRESSUS SEMPERVIRENSITALIAN CYPRESSLAGERSTROEMIA INDICACRAPE MYRTLEOLEA EUROPAEA 'WILSONII'WILSON OLIVEWASHINGTON ROBUSTAMEXICAN FAN PALMPINUS ELDARICAMONDELL PINESCHINUS MOLLECALIFORNIA PEPPER TREESHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996HOA PARK PLAN3PLOT DATE DECEMBER 27 2016CONCEPTUAL PARK PLAN6 SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996WALL AND FENCE PLAN3PLOT DATE DECEMBER 27 2016 TITLE SHEET190'4&'8'.12'4(4106+'4%1//70+6+'576+%##8'07'57+6'4#0%*1%7%#/10)#%#%106#%62'4510/#66*'9'537+8'.241,'%62.#00'41((+%'ÄÄ.#0&5%#2'#4%*+6'%6.#06':.#0&5%#2'#4%*+6'%674'Ä2.#00+0)%#/+01%#2+564#0157+6'.#)70#0+)7'.%#  Ä%106#%62'4510$.#-'*+0/#0'/#+.#&&4'55$.#-'*+0/#0".#06':.#%1/T-1'0)+0''45&'0)+0''4+0)#0&#551%+#6'5'#+42146&4+8'56'5#0$'40#4&+01%#2*  Ä#660574'5*&1&&+#*+0&':/#2065LAKE ELSINORE, CALIFORNIAWALL AND FENCE PLANSTRACT 32996SHEET INDEX6Ä9Ä9Ä6+6.'5*''69#..#0&('0%'2.#09#..#0&('0%'&'6#+.51 2231113322113322332222222132333222211134331PRODUCTION AND MATERIALS SCHEDULEPRODUCTION WALL AND FENCESSYMBOLDESCRIPTIONDETAIL / SHEET NO.3' VINYL GATEDETAIL 'D' SHEET W-2VINYL FENCEDETAIL 'C' SHEET W-26' SPLIT-FACE BLOCK WALLDETAIL 'A' SHEET W-2VEHICULAR GATE - 2 - 6' RAIL VINYL DOUBLE DRIVEGATEDETAIL 'B' SHEET W-21234SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996WALL AND FENCE PLAN3PLOT DATE DECEMBER 27 2016WALL AND FENCE PLANW-12 BLOCK WALL8+0;.)#6'Ä9*+6'INSTALL 4x4 VINYL POST FOR GATE PERMANUFACTURERS RECOMMENDATIONSFINISH GRADE(3) HEAVY-DUTY HINGES, EQUALLYSPACEDCANE BOLTLOCK AND LATCH BY OWNERELEVATION6' BLOCK WALL, GREYFINISH GRADE8" PRECISION CAP - GREYSPLIT FACE ON OUTSIDE OF WALLPRECISION FACE ON INSIDE OF WALLTOP ROW - BLOCK PRECISION - TAN BOTH SIDESSIDE OF HOUSE8+0;.)#6'Ä9*+6'INSTALL 4x4 VINYL POST FOR GATE PERMANUFACTURERS RECOMMENDATIONSFINISH GRADEBLOCK WALL(3) HEAVY-DUTY HINGES, EQUALLYSPACED)#6'#6.16Ä$#5+0065$%105647%6+10&'6#+.59ÄSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996WALL AND FENCE PLAN3PLOT DATE DECEMBER 27 2016 8+0;.('0%'065%ž8+0;.)#6'065&ž52.+6Ä(#%'$.1%-9#..065# SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613 LAKE ELSINORE, CALIFORNIAMODEL PLANSTRACT 32996 TITLE SHEETSHEET INDEX6Ä%Ä%&Ä61%&Ä+Ä+Ä+&Ä61+&Ä2Ä612Ä2&Ä5+Ä52Ä6+6.'5*''6%105647%6+102.#0%105647%6+10&'6#+.5+44+)#6+102.#0+44+)#6+10.')'0&+44+)#6+10&'6#+.52.#06+0)2.#02.#06+0)&'6#+.5+44+)#6+1052'%+(+%#6+1052.#06+0)52'%+(+%#6+105190'4&'8'.12'4(4106+'4%1//70+6+'576+%##8'07'57+6'4#0%*1%7%#/10)#%#%106#%62'4510/#66*'9'537+8'.241,'%62.#00'41((+%'ÄÄ.#0&5%#2'#4%*+6'%6.#06':.#0&5%#2'#4%*+6'%674'Ä2.#00+0)%#/+01%#2+564#0157+6'.#)70#0+)7'.%#  Ä%106#%62'4510$.#-'*+0/#0'/#+.#&&4'55$.#-'*+0/#0".#06':.#%1/T-1'0)+0''45&'0)+0''4+0)#0&#551%+#6'5'#+42146&4+8'56'5#0$'40#4&+01%#2*  Ä#660574'5*&1&&+#*+0&':/#2065MODEL LOCATION1 PLAN 2ALOT 5PLAN 3RCLOT 4PLAN 1RBLOT 6PARKINGLOT 7LOT 8TOTLOTHCTEMPORARYSALESTRAILERHCCL619211817206653'7'3'7'512122772481292423221656651415132410116112526124132212558'8' 2' 2'6'-9"7'-6" 15'15'3'4'12'252512'10' 22'4'5'5'4'18'12'5'7'-10"10'11'11'2'8'3' 17'15'1'6'-9"10'5'3' 10'8'20'6'-9"6'5'12'5'42' 4'3' 2' 4'1824510'5'2'-3"2'-3"52830303029292931316619FALLOWFALLOWFALLOW29327'1. SALES TRAILER BY OWNER - TEMPORARY2. CONCRETE SIDEWALK MEDIUM BROOM FINISH3. HANDICAP RESTROOM - TO BE MOVED TO SIDE OF MODEL WHEN TRAILER IS REMOVED4. PARKING LOT BY CIVIL ENGINEER5. VINYL FENCE TEMPORARY - SEE DETAIL 'D' SHEET CD-16. VINYL FENCE PER DETAIL 'D' SHEET CD-17. WALKWAY WITH PRODUCTION SIDEWALK FINISH8. WALKWAY WITH PRODUCTION SIDEWALK FINISH9. WALKWAY WITH PRODUCTION SIDEWALK FINISH10. GATE TO MATCH FENCE - 5' WIDE FOR HANDICAP ACCESS PER DETAIL 'E' SHEET CD-111. 5' CONCRETE WALK WITH MEDIUM BROOM FINISH12. PRODUCTION SIDEWALK PER CIVIL PLANS13. CONCRETE PATIO WITH MEDIUM BROOM FINISH AND SCORED DIAGONALLY AT 3'14. TOT LOT PER DETAIL 'C' SHEET CD-1 - EQUIPMENT BY OWNER15. CONCRETE STEP STONES WITH MEDIUM BROOM FINISH16. CONCRETE DECK WITH MEDIUM EXPOSED AGGREGATE FINISH17. CONCRETE DECK WITH SALT FINISH18. 2' WIDE 2" DEEP - BLACK BARK MULCH PATH19. BENCH BY OWNER20. CONCRETE DECK TO MATCH NOTE #1721. BIRDBATH - MPG SPECIAL AGED GRANITE FINISH OR EQUAL FROM HOME DEPOT OR EQUAL22. FIRE PIT - MAISON 30" - COPPER FINISH BY HAMPTON BAY FROM HOME DEPOT OR EQUAL23. CHAIRS BY OWNER24. SPLIT-FACE BLOCK WALL PER DETAIL 'F' SHEET CD-225. TRAP FENCE PER DETAIL 'A' SHEET CD-126. 3' WIDE TRAP FENCE GATE PER DETAIL 'B' SHEET CD-127. 2 - 6' TRAP FENCE GATES PER DETAIL 'B' SHEET CD-1BY OWNER28. HANDICAP RESTROOM FROM SALES TRAILER 6'-9" L x 6' W OR SMALLER29. MODEL COMPLEX SIGNAGE BY OWNER30. TYPICAL 3' x 7' CONCRETE PAD FOR TRASH CANS / ON LOT 6 POUR TYPICAL 3' x 7'CONCRETE PAD UNDER HC RESTROOM31. 3' GATE PER DETAIL 'E' SHEET CD-132. UTILITY PER CIVIL PLANCONSTRUCTION LEGENDSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613CONSTRUCTION PLANC-12 +056#..+0%*28%2+2'5.''8':+0%*&''2614'%'+8'%#0'$1.6219'4%1#6'&*+0)'612 $1661/:14:4+$$'&4#+.52156%#26475541&(145722146)4#&':2156:&1/'&%10%4'6'(116+0)219&'4%1#6'&.#6%*%#0'$1.6Äžž/+0%.'#4#0%')#6'.16ž ž)#6'.16)4#&'2156%#2:14:4+$$'&4#+.5016'%1.1459*+6'žÄž+056#..+0%*28%2+2'5.''8':+0%*&''2614'%'+8'%#0'$1.6:2156:&1/'&%10%4'6'(116+0)Ä4#+.8+0;.('0%'SIDE OF HOUSE8+0;.)#6'INSTALL 4x4 VINYL POST FOR GATE PERMANUFACTURERS RECOMMENDATIONSFINISH GRADESPLIT-FACE BLOCK WALL(3) HEAVY-DUTY HINGES, EQUALLY SPACED -PER SWING DIRECTION ON PLAN10"2"6"6"2 x 12 REDWOOD HEADERBARK MULCHF.G.1x2x12 STAKE @ 3' O.C.8"Ä4#+.8+0;.&17$.'&4+8')#6'64#2('0%'&'6#+.065$64#2('0%'Ä4#+.8+0;.&'6#+.065#%105647%6+10&'6#+.5%&ÄSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613 8+0;.('0%'065&8+0;.ž)#6'#65#.'51((+%'ž241&%76+10065'616.16$14&'4065% ELEVATION6' BLOCK WALL, GREYFINISH GRADE8" PRECISION CAP - GREYSPLIT FACE ON OUTSIDE OF WALLPRECISION FACE ON INSIDE OF WALLTOP ROW - BLOCK PRECISION - TAN BOTH SIDES%105647%6+10&'6#+.5%&ÄSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613 ž52.+6Ä(#%'$.1%-9#..065( PLAN 2ALOT 5PLAN 3RCLOT 4PLAN 1RBLOT 6PARKINGLOT 7LOT 8TOTLOTHCTEMPORARYSALESTRAILERHCFALLOWFALLOWFALLOWFAAFFFMFFAFAFAFFFMFAMFFAAFFFFFFFFFAAAACRECRECRESHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613IRRIGATION PLANI-15 SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613+44+)#6+10.')'0&+Ä 2POP-UP BUBBLERFINISHED GRADE IN TURF AREAS54"12"1CONTROLLER3POINT TO POINT DRIPPLAN VIEW - N.T.S.SECTION VIEW - N.T.S.EMITTER SCHEDULE1 PER 1 GAL. SHRUB (2 GPH)2 PER 5 GAL. SHRUB (4 GPH)3 PER 15 GAL. SHRUB (6 GPH)SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613+44+)#6+10&'6#+.5+&Ä 11BALL VALVEWECR1PRIVATE LOT POC3SLEEVE INSTALLATION5DRIP ANTI-SIPHON VALVE4PIPE INSTALLATION9DRIP FLUSH VALVE8DRIP AIR RELIEF VALVEUV RESISTANT PVC SCH 40 PIPEFINISH GRADE/TOP OF MULCHPVC LATERAL PIPE18-IN MIN. (1 OF 2) (1 OF 2)PVC SCH 40 ELLSEE LEGEND FOR TYPECONTROL ZONE KIT: HIGHEST POINT OF DISCHARGEINSTALL 6-INCH MIN. ABOVE30-INCH LINEAR LENGTH OF WIRE, COILEDWATERPROOF CONNECTION: CHANGES IN DIRECTION OF PRESSURE MAINLINE AND AT ALLMAINLINE (WHERE APPLICABLE). INSTALL 1'x1'x1' THRUST AT ALLTHE CITY. 36" MIN. COVER IS REQUIRED FOR RECLAIMED WATERSPLICING OF WIRE RUNS IS NOT ALLOWED UNLESS APPROVED BYCONTROL WIRES AT ALL 90 DEGREE CHANGES IN DIRECTION.BUNDLE AND TAPE WIRES AT 12' O.C. PIGTAIL AND LOOP6. PROVIDE 2" OF CLEAN SAND BELOW PRESSURE MAINLINE5. CONTROL WIRES - INSTALL BELOW PRESSURE SUPPLY LINE2. CLEAN BACKFILL - 90% COMPACTION REQUIRED - SEE SPECS4. PRESSURE SUPPLY LINE PER LEGENDTERMINAL POINTS OF MAINLINE.NOTES:1. FINISH GRADE3. NON-PRESSURE LATERAL LINE PER LEGEND18" MIN. - SEE SPECS 12"3. SAND (TYPICAL)4. NON-PRESSURE LATERAL LINE / SLEEVE (SIZE PER CHART)6. PRESSURE SUPPLY LINE / SLEEVE (SIZE PER CHART)ENDS. ON PLANS. EXTEND SLEEVES 12" BEYOND EDGE OF HARDSCAPE ON BOTHALL SLEEVES TO BE SCH 40 PVC. SIZE ALL SLEEVES PER SLEEVING CHART5. CONTROL WIRE SLEEVE ADJACENT TO MAINLINE SLEEVE (SIZE PER CHART)NOTES:24" MIN. OR PER SPECS 2. CLEAN BACKFILL - 90% COMPACTION REQUIRED - SEE SPECS1. HARDSCAPE (TYPICAL)2"6"12'' MIN. IPS FLEXHOSE EXTENSIONFINISHP.V.C. SCHEDULE 40 ELLP.V.C. PIPE OR POLYTUBINGAS APPLICABLE GRADE12''PLASTIC CONTROL BOX W/BOLT DOWN END FLUSH BALLCHECK VALVEBRICKS AT EACHCORNER OF BOX2''1''1. 2'' DEEP LAYER MULCH MATERIAL AS PER SPECIFICATIONS.MULCH LAYER(SEE NOTE 1)SET BOX 1'' ABOVEMULCH LAYERNOTE:PVC PIPING AND FITTING(THREE)BRICK SUPPORTSVALVE BOX6" ROUND(LENGTH AS REQUIRED)SCH. 80 NIPPLEAIR/VACUUM RELIEFFINISHNOTES:1. 2'' DEEP LAYER MULCH MATERIAL ASPER SPECIFICATIONS.1''2''MULCH LAYER(SEE NOTE 1)SET BOX 1'' ABOVEMULCH LAYERGRADELOWER THAN DRIPLINE LATERALS.2. AIR VACUUM RELIEF VALVE CANNOT BE CONNECTED APPLY SEALER TO OUTSIDE OF SEALING PUT CRIMP SLEEVE OVER WIRE ENDS - PUSH SEALING PLUG INTO BASE SOCKET.PUSH WIRES TO END OF BASE SOCKET SLIP BASE SOCKET OVER ENDS OF WIRES. STRIP WIRES APPROX. 3/8" FROM ENDS - PULL BASE SOCKET OVER CRIMPED CON- RAIN BIRD "SNAP-TITE" WIRE CONNECTOR NECTION AS FAR AS POSSIBLE.8. OR APPROVED EQUAL. CONNECTION. TO ASSURE COMPLETE SEALING OF 7. 6. PLUG - FILL CAVITY WITH SEALER. CRIMP AND CUT OFF EXCESS WIRE. 3. 4. 5. TWIST TOGETHER. 1. 2.2WIRE CONNECTION LID10ANTI-SIPHON VALVESECTION VIEW - N.T.S.SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613+44+)#6+10&'6#+.5+&Ä PLAN 2ALOT 5PLAN 3RCLOT 4PLAN 1RBLOT 6PARKINGLOT 7LOT 8TOTLOTHCTEMPORARYSALESTRAILERHCRLPCPCGPGPGPGPRIRIRIRIRLSMSMAUAUCCCCAUPGRIRIEDEDEDCACACACAPCPCPCFSFSFSFSFSFSRLPGPGPGPGSMSMSMSMSMSMSMSMSMSMSMRIRIAUAUAUDPPPDDPPPPP FALLOWFALLOWFALLOW21.;2412;.'0'9+6*9#..5#5/#07(#%674'$;&''24116%1/2#0;%1PLANTING SCHEDULETREESSYMBOTANICAL NAMECOMMON NAMEQTYSIZEWUCOLGROWTHSIZE H/WAUARBUTUS UNEDOSTRAWBERRY TREE324" BOXL20' x 20'CCCINNAMOMUM CAMPHORACAMPHOR TREE224" BOXM50' x 60'CACUPANIOPSIS ANACARDIOIDESCARROT WOOD424" BOXM40' x 30'EDERIOBOTRYA DEFLEXABRONZE LOQUAT324" BOXM20' x 20'FSFEIJOA SELLOWIANAPINEAPPLE GUAVA624" BOXL20' x 20'GPGEIJERA PARVIFLORAAUSTRALIAN WILLOW1024" BOXM27' x 20'PGPODOCARPUS GRACILIORFERN PINE524" BOXM40' x 15'PCPRUNUS CAROLINIANACAROLINA CHERRY524" BOXM25' x 20'RIRHAPHIOLEPIS INDICA 'MAJESTIC BEAUTY'MAJESTIC BEAUTY HAWTHORN824" BOXM23' x 28'RLRHUS LANCEAAFRICAN SUMAC324" BOXL25' x 28'SMSCHINUS MOLLECALIFORNIA PEPPER TREE1324" BOXL32' x 32'VINES DDISTICTIS BUCCINATORIABLOOD RED TRUMPET VINE25 GAL.M25' H PPANDOREA JASMINOIDESBOWER VINE35 GAL.M25' HNOTE TO CONTRACTOR: IF GRAPHIC REPRESENTATION OF PLANTINGS ON PLANS DOES NOT MATCH QUANTITIES IN PLANT LIST, GRAPHICREPRESENTATION OF PLANTINGS ON PLANS WILL GOVERN.#..64''59+6*+0žÄ1(*#4&5%#2'5*#..4'%'+8'4116$#44+'45241&7%6.+$Ä.14610#8'576'$74.+0)#/'%#%+6;56#0&#4&+056#...+0'#44116$#44+'452'4%+6;56#0&#4&514$+1$#44+'4SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613TREE PLANTING PLANP-19 PLAN 2ALOT 5PLAN 3RCLOT 4PLAN 1RBLOT 6PARKINGLOT 7LOT 8TOTLOTHCTEMPORARYSALESTRAILERHCCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPSLSLSLSLLDLDLDLDLDLDEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDLDRHRHRHRHRHRHRHRHRHRHSCSCSCSCWFRHWFWFWFWFWFWFWFWFWFWFWFWFWFRHRHRHRHRHRHRHRHRHRHRHRHRHROROROROROROROROROROROROROROROROROROLDLDLDLDLDLDLDLDLDLDLDWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFWFLDLDLDLDLDLDLDLDLDLDLDLDRORORORORORORHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHRHLDLDRHRHRHRHRHRHRHRHCCCCCCCCGNGNGNSGGNGNGNGNGNGNGNGNGNSGSGSGSGSGSGSGSGSGSGLALALALALASGGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNSGSGSGSGSGSGSGSGSGSGSGSGLALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALALASGSGSGSGSGSGSGSGSGSGCCCCCCCCCCCCGNGNGNGNGNGNGNGNGNGNGNGNGNGNCCCCCCCCCCCCCCCCGNGNGNGNGNGNGNGNGNGNHAHAGNHAHAHAHAGNGNGNHAHAHAHAHAHAGNLMLMLMLMLMLMLMLMLMRFRFRFRFRFRFRFLMLMLMLMLMLMLMLMLMLMLMSLSLSLSLSLSLSLCPCPLMLMLMLMLMLMLMLMCPCPCPCPCPLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMEPEPEPEPEPEPEPLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMRFRFLMLMRFRFLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMLMEPEPEPEPEPEPEPEPCPCPCPCPCPEPEPCPCPEPEPEPEPEPEPCPCPCPEPEPEPEPEPCPCPCPEPEPEPEPSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLEPEPEPEPEPEPEPEPFALLOWFALLOWFALLOWBARK MULCHBARK MULCHBARK MULCHPLANTING SCHEDULESHRUBSSYMBOLBOTANICAL NAMECOMMON NAMEQTYSIZEWUCOLGROWTHSIZE H/WCCCALLIANDRA CALIFORNICABAJA FAIRY DUSTER1815 GAL.L4' x 4'CPCOTONEASTER PARNEYPARNEY COTONEASTER7215 GAL.L8' x 10'EPEURYOPS PECTINATUSSHRUB DAISY755 GAL.L4' x 4'GNGREVELIA 'NOELLII'NOEL'S GREVELLIA5615 GAL.L4' x 4'HAHETEROMELES ARBUTIFOLIATOYON1215 GAL.L8' x 8'LMLANTANA MONTEVIDENSIS (GOLD CULTIVARS)TRAILING LANTANA1035 GAL.L2' x 6'LALAVANDULA ANGUSTIFOLIAENGLISH LAVENDER485 GAL.L2' x 2'LDLAVANDULA DENTATAFRENCH LAVENDER505 GAL.L4' x 6'RORHUS OVATASUGAR BUSH245 GAL.L10' x 10'RFROSA FLORIBUNDA 'ICEBERG'ICEBERG ROSE115 GAL.L3' x 3'RHROSMARINUS O. 'HUNTINGTON CARPET'HUNTINGTON CARPETROSEMARY551 GALL2' x 10'SCSALVIA CLEVELANDII & HYBRIDSSALVIA45 GAL.L5' x 8'SGSALVIA GREGGIIAUTUMN SAGE345 GAL.L4' x 4'SLSALVIA LEUCANTHAMEXICAN BUSH SAGE405 GAL.L4' x 6'WFWESTRINGIA FRUTICOSACOAST ROSEMARY405 GAL.L3' x 3'GROUNDCOVERSO.C. SPACINGBACCHARIS P. PILULARIS "TWIN PEAKS"DWARF COYOTE BUSH411 GAL.L15" x 8'4'OSTEOSPERMUM FRUTICOSUMTRAILING AFRICAN DAISY2691 GAL.L9" x 3'2'TURF - ARTIFICIALPARKWAYBACCHARIS P. PILULARIS "TWIN PEAKS"DWARF COYOTE BUSH341 GAL.L15" x 8'4'PARKWAY3" SHREDDED BARK MULCHNOTE TO CONTRACTOR: IF GRAPHIC REPRESENTATION OF PLANTINGS ON PLANS DOES NOT MATCH QUANTITIES IN PLANT LIST, GRAPHICREPRESENTATION OF PLANTINGS ON PLANS WILL GOVERN.SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613SHRUB PLANTING PLANP-210 LOCATE PLANTS EQUALLY (TRIANGULAR SPACED)PER SPACING INDICATED ON PLANSSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 2016132.#06+0)&'6#+.552Ä SECTION 02810LANDSCAPE IRRIGATIONPART 1 - GENERAL1.1SummaryA.It is the intent of the specifications and drawings that the finished system is complete in every respect and shall be ready foroperation satisfactory to the Owner.B.The work shall include all materials, labor, services, transportation, and equipment necessary to perform the work as indicatedon the drawings, in these specifications, and as necessary to complete the contract.1.2Construction DrawingsA.Due to the scale of the drawings, it is not possible to indicate all offsets, fittings, sleeves, etc. which may be required. TheContractor shall carefully investigate the structural and finished conditions affecting all of his work and plan his work accordingly,furnishing such fittings, etc. as may be required to meet such conditions. Drawings are generally diagrammatic and indicative ofthe work to be installed. The work shall be installed in such a manner as to avoid conflicts between irrigation systems, planting,and architectural features.B.All work called for on the drawings by notes or details shall be furnished and installed whether or not specifically mentioned inthe specifications. When an item is shown on the plans but not shown on the specifications or vice versa, it shall be deemed tobe as shown on both. The Landscape Architect shall have final authority for clarification.C.The Contractor shall not willfully install the irrigation system as shown on the drawings when it is obvious in the field thatobstructions, grade differences or discrepancies in area dimensions exist that might not have been considered in engineering.Such obstructions or differences should be brought to the attention of the Landscape Architect as soon as detected. In theevent this notification is not performed, the Irrigation Contractor shall assume full responsibility for any revision necessary.1.3Quality AssuranceA.Provide at least one English speaking person who shall be present at all times during execution of this portion of the work andwho shall be thoroughly familiar with the type of materials being installed and the manufacturer's recommended methods ofinstallation and who shall direct all work performed under this section.B.Manufacturer's directions and detailed drawings shall be followed in all cases where the manufacturer of articles used in thiscontract furnish directions covering points not shown in the drawings and specifications.C.All local, municipal, and state laws, rules and regulations governing or relating to any portion of this work are herebyincorporated into and made a part of these specifications, and their provisions shall be carried out by the Contractor. Anythingcontained in these specifications shall not be construed to conflict with any of the above rules and regulations of the same.However, when these specifications and drawings call for or describe materials, workmanship, or construction of a better quality,higher standard, or larger size than is required by the above rules and regulations, the provisions of these specifications anddrawings shall take precedence.D.All materials supplied for this project shall be new and free from any defects. All defective materials shall be replacedimmediately at no additional cost to Owner.E.The Contractor shall secure the required licenses and permits including payments of charges and fees, give required notices topublic authorities, verify permits secured or arrangements made by others affecting the work of this section.1.4SubmittalsA.Materials List:1.After award of contract and before any irrigation system materials are ordered from suppliers or delivered to the job site,submit to the Owner a complete list of all irrigation system materials, or processes proposed to be furnished and installed aspart of this contract.2.The submittals shall include the following information:a.A title sheet with the job name, the contractors name, contractor's address and telephone number, submittal date andsubmittal number.b.An index sheet showing the item number (i.e. 1,2,3, etc.); an item description (i.e. sprinkler head); the manufacturer'sname (i.e. Hunter Industries); the item model number (i.e. I-40-ADV/36V); and the page(s) in the submittal set thatcontain the catalog cuts.c.The catalog cuts shall be one or two pages from the most recent manufacturer's catalog that indicate the productsubmitted. Do not submit parts lists, exploded diagrams, price lists or other extra information.d.The catalog cuts shall clearly indicate the manufacturer's name and the item model number. The item model number, allspecified options and specified sizes shall be circled on the catalog cuts.e.Submittals for equipment indicated on the legend without manufacturer names, or "as approved", shall contain themanufacturer, Class or Schedule, ASTM numbers and/or other certifications as indicated in these specifications.f.Submittal format requirements:g.Submittals shall be provided as one complete package for the project. Multiple partial submittals will not be reviewed.h.Submittal package shall be stapled or bound in such a way as to allow for disassembly for review processing.i.Submittal package shall have all pages numbered in the lower right hand corner. Page numbers shall correspond withsubmittal index.3.The Landscape Architect or Owner's authorized representative will allow no substitutions without prior written acceptance.4.Manufacturer's warranties shall not relieve the Contractor of his liability under the guarantee. Such warranties shall onlysupplement the guarantee.5.The Landscape Architect or Owner's authorized representative will not review the submittal package unless provided in theformat described above.B.Substitutions: If the Irrigation Contractor wishes to substitute any equipment or materials for those equipment or materials listedon the irrigation drawings and specifications, he may do so by providing the following information to the Landscape Architect orOwner's authorized representative for approval.1.Provide a written statement indicating the reason for making the substitution.2.Provide catalog cut sheets, technical data, and performance information for each substitute item.3.Provide in writing the difference in installed price if the item is accepted.1.5Existing ConditionsA.The Contractor shall verify and be familiar with the locations, size and detail of points of connection provided as the source ofwater, electrical supply, and telephone line connection to the irrigation system.1.Irrigation design is based on the available static water pressure shown on the drawings. Contractor shall verify static wateron the project prior to the start of construction. Should a discrepancy exist, notify the Landscape Architect and Owner'sauthorized representative prior to beginning construction.2.Prior to cutting into the soil, the Contractor shall locate all cables, conduits, sewer septic tanks, and other utilities as arecommonly encountered underground and he shall take proper precautions not to damage or disturb such improvements. If aconflict exists between such obstacles and the proposed work, the Contractor shall promptly notify the Landscape Architectand Owner who will arrange for relocations. The Contractor will proceed in the same manner if a rock layer or any othersuch conditions are encountered.3.The Contractor shall protect all existing utilities and features to remain on and adjacent to the project site during construction.Contractor shall repair, at his own cost; all damage resulting from his operations or negligence.4.The Irrigation Contractor shall coordinate with the General Contractor for installation of required sleeving as shown on theplans prior to paving operations.5.The Contractor shall verify and be familiar with the existing irrigation systems in areas adjacent to and within the Project areaof work.6.The Contractor shall protect all existing irrigation systems, in areas adjacent to and within the project area of work, fromdamage due to his operations.7.Contractor shall notify Owner's Representative if any existing system is temporarily shut off, capped or modified. Provide48-hour notice, prior to turning off or modifying any existing irrigation system. C. Inspections will be required for the following at a minimum:1.System layout2.Pressure test of irrigation mainline (Four hours at 125 PSI or 120% of static water pressure, which ever is greater.) Mainlinepressure loss during test shall not exceed 2 PSI.3.Coverage test of irrigation system. Test shall be performed prior to any planting.4.Final inspection prior to start of maintenance period5.Final acceptanceD.Site observations and testing will not commence without the field record drawings as prepared by the Irrigation Contractor.Record drawings must complete and up to date for each site visit.E.Work that fails testing and is not accepted will be retested. Hourly rates and expenses of the Landscape Architect, Owner'sauthorized representative, and governing agencies for reinspection or retesting will be paid by the Irrigation Contractor at noadditional expense to Owner.1.7Storage and HandlingA.Use all means necessary to protect irrigation system materials before, during, and after installation and to protect the installationwork and materials of all other trades. In the event of damage, immediately make all repairs and replacements necessary to theacceptance of the Landscape Architect and Owner and at no additional cost to the Owner.B.Exercise care in handling, loading, unloading, and storing plastic pipe and fittings under cover until ready to install. Transportplastic pipe only on a vehicle with a bed long enough to allow the pipe to lay flat to avoid undue bending and concentratedexternal load.1.8Cleanup and DisposalA.Dispose of waste, trash, and debris in accordance with applicable laws and ordinances and as prescribed by authorities havingjurisdiction. Bury no such waste material and debris on the site. Burning of trash and debris will not be permitted. TheContractor shall remove and dispose of rubbish and debris generated by his work and workmen at frequent intervals or whenordered to do so by the Owner's authorized representative.B.At the time of completion the entire site will be cleared of tools, equipment, rubbish and debris which shall be disposed of off-sitein a legal disposal area.1.9CompletionA.At the time of the pre-maintenance period inspection, the Landscape Architect, Owner's authorized representative, andgoverning agencies will inspect the work, and if not accepted, will prepare a list of items to be completed by the Contractor.Punch list to be checked off by contractor and submitted to Landscape Architect or Owner's Authorized representative prior toany follow-up meeting. This checked off list to indicate that all punch list items have been completed. At the time of thepost-maintenance period or final inspection the work will be re-inspected and final acceptance will be in writing by theLandscape Architect, Owner's authorized representative, and governing agencies.B.The Owner's authorized representative shall have final authority on all portions of the work.C.After the system has been completed, the Contractor shall instruct Owner's authorized representative in the operation andmaintenance of the irrigation system and shall furnish a complete set of operating and maintenance instructions.D.Any settling of trenches which may occur during the one-year period following acceptance shall be repaired to the owner'ssatisfaction by the Contractor without any additional expense to the owner. Repairs shall include the complete restoration of alldamage to planting, paving or other improvements of any kind as a result of the work.1.10GuaranteeA.The entire sprinkler system, including all work done under this contract, shall be unconditionally guaranteed against all defectsand fault of material and workmanship, including settling of backfilled areas below grade, for a period of one (1) year followingthe filing of the Notice of Completion.B.Should any problem with the irrigation system be discovered within the guarantee period, it shall be corrected by the Contractorat no additional expense to owner within ten (10) calendar days of receipt of written notice from Owner. When the nature of therepairs as determined by the Owner constitute an emergency (i.e. broken pressure line) the Owner may proceed to makerepairs at the Contractor's expense. Any and all damages to existing improvement resulting either from faulty materials orworkmanship, or from the necessary repairs to correct same, shall be repaired to the satisfaction of the owner by the Contractor,all at no additional cost to the Owner.C. Guarantee shall be submitted on Contractors own letterhead as follows:GUARANTEE FOR SPRINKLER IRRIGATION SYSTEMWe hereby guarantee that the sprinkler irrigation system we have furnished and installed is free from defects in materials andworkmanship, and the work has been completed in accordance with the drawings and specifications, ordinary wear and tearand unusual abuse, or neglect excepted. We agree to repair or replace any defective material during the period of one yearfrom date of filing of the Notice of Completion and also to repair or replace any damage resulting from the repairing orreplacing of such defects at no additional cost to the owner. We shall make such repairs or replacements within 10 calendardays following written notification by the owner. In the event of our failure to make such repairs or replacements within thetime specified after receipt of written notice from owner, we authorize the owner to proceed to have said repairs orreplacements made at our expense and we will pay the costs and charges therefore upon demand.PROJECT NAME:PROJECT LOCATION:CONTRACTOR NAME:ADDRESS:TELEPHONE:SIGNED:DATE:PART 2 - MATERIALS2.1SummaryA.Use only new materials of the manufacturer, size and type shown on the drawings and specifications. Materials or equipmentinstalled or furnished that do not meet Landscape Architect's, Owner's, or governing agencies standards will be rejected andshall be removed from the site at no expense to the Owner.2.2PipeA.Pressure supply lines 1 1/2 inches in diameter and smaller downstream of the backflow prevention unit shall be Schedule 40solvent weld PVC conforming to ASTM D1785.B.Non-pressure lines 3/4 inch in diameter and larger downstream of the remote control valve shall be Class 200 solvent weld PVCconforming to ASTM D2672.2.3Metal Pipe and FittingsA.Brass pipe shall be 85 percent red brass, ANSI, IPS Standard 125 pounds, Schedule 40 screwed pipe.B.Fittings shall be medium brass, screwed 125-pound class.C.Copper pipe and fittings shall be Type "K" sweat soldered.2.4Plastic Pipe and FittingsA.Pipe shall be marked continuously with manufacturer's name, nominal pipe size, schedule or class, PVC type and grade,National Sanitation Foundation approval, Commercial Standards designation, and date of extrusion.B.All plastic pipe shall be extruded of an improved PVC virgin pipe compound in accordance with ASTM D2672, ASTM D2241 orASTM D1785.C.All solvent weld PVC fittings shall be standard weight Schedule 40 (and Schedule 80 where specified on the irrigation detailsheet) and shall be injection molded of an improved virgin PVC fitting compound. Slip PVC fittings shall be the "deep socket"bracketed type. Threaded plastic fittings shall be injection molded. All tees and ells shall be side gated. All fittings shallconform to ASTM D2464 and ASTM D2466.2.All ball valves shall have a minimum working pressure of not less than 150 PSI and shall conform to AWWA standards.A.Automatic Control Valves:1.Automatic control valves shall be of the manufacturer, size, and type indicated on the drawings.2.Automatic control valves shall be electrically operated.2.6Valve BoxesA.Valve boxes shall be fabricated from a durable, weather-resistant plastic material resistant to sunlight and chemical action ofsoils.B.The valve box cover shall be green in color and secured with a hidden latch mechanism or bolts.C.The cover and box shall be capable of sustaining a load of 1,500 pounds.D.Valve box extensions shall be by the same manufacturer as the valve box.E.The plastic irrigation valve box cover shall be an overlapping type.F.Pressure regulating valve boxes shall be 16"x11"x12" 'nominal' rectangular size. Valve box covers shall be marked "PRV" "heatbranded" onto the cover in 1-1/4 inch high letters / numbers.G.Ball valve boxes shall be 10" circular size. Valve box covers shall be marked with "BV" "heat branded" onto the cover in 1-1/4inch high letters.2.7 Automatic ControllerA.Automatic controller shall be of the manufacturer, size, and type indicated on the drawings.B.Controller enclosure shall be of the manufacturer, size, and type indicated on the drawings.2.8 ElectricalA.All electrical equipment shall be NEMA Type 3, waterproofed for exterior installations.B.All electrical work shall conform to local codes and ordinances.2.9Low Voltage Control WiringA.Remote control wire shall be direct-burial AWG-UF type, size as indicated on the drawings, and in no case smaller than 14gauge.B.Connections shall of the manufacturer, size, and type indicated on the drawings.C.Ground wires shall be white in color. Control wires shall be red (where two or more controllers are used, the control wires shallbe a different color for each controller. These colors shall be noted on the "Record Drawings" plans located on controller door).2.13Irrigation Heads and Drip EmittersA.Irrigation heads and drip emitters shall be of the manufacturer, size, type, with radius of throw, operating pressure, anddischarge rate indicated on the drawings.B.Irrigation heads and drip emitters shall be used as indicated on the drawings.C.Irrigation heads shall have purple reclaimed water warning cover.2.14Drip Irrigation EquipmentA.Drip tubing equipment such as flush valves, air relief valves, wye strainers and pressure regulators shall be of the manufacturer,size, and type indicated on the drawings.2.11Miscellaneous EquipmentA.Landscape Fabric:1.Landscape fabric for valve box assemblies shall be 5.0- oz. weight woven polypropylene weed barrier. Landscape fabricshall have a burst strength of 225 PSI, a puncture strength of 60 lbs. and capable of water flow of 12 gallons per minute persquare foot.2.Type: DeWitt Pro 5 Weed Barrier or approved equal.B.Equipment such as ET sensors, flush valves, air relief valves and wye strainers shall be of the manufacturer, size and typeindicated on the drawings.PART 3 - EXECUTION3.1Site ConditionsA.Inspections:1.Prior to all work of this section, carefully inspect the installed work of all other trades and verify that all such work is completeto the point where this installation may properly commence.2.Verify that irrigation system may be installed in strict accordance with all pertinent codes and regulations, the original design,the referenced standards, and the manufacturer's recommendations.B.Discrepancies:1.In the event of discrepancy, immediately notify the Landscape Architect or Owner's authorized representative.2.Do not proceed with installation in areas of discrepancy until all discrepancies have been resolved.C.Grades:1.Before starting work, carefully check all grades to determine that work may safely proceed, keeping within the specifiedmaterial depths with respect to finish grade.2.Final grades shall be accepted by the Engineer before work on this section will be allowed to begin.D.Field Measurements:1.Make all necessary measurements in the field to ensure precise fit of items in accordance with the original design.Contractor shall coordinate the installation of all irrigation materials with all other work.2.All scaled dimensions are approximate. The Contractor shall check and verify all size dimensions prior to proceeding withwork under this section.3.Exercise extreme care in excavating and working near existing utilities. Contractor shall be responsible for damages toutilities, which are caused by his operations or neglect.E.Diagrammatic Intent:1.The drawings are essentially diagrammatic. The size and location of equipment and fixtures are drawn to scale wherepossible. Provide offsets in piping and changes in equipment locations as necessary to conform with structures and to avoidobstructions or conflicts with other work at no additional expense to Owner.3.3BackfillingA.Backfill material on all lines shall be the same as adjacent soil free of debris, litter, and rocks over 1/2 inch in diameter.1.Backfill shall be tamped in 4-inch layers under the pipe and uniformly on both sides for the full width of the trench and the fulllength of the pipe. Backfill materials shall be sufficiently damp to permit thorough compaction, free of voids. Backfill shall becompacted to dry density equal to adjacent undisturbed soil and shall conform to adjacent grades.2.Flooding in lieu of tamping is not allowed.3.Under no circumstances shall truck wheels be used to compact backfill.4.Provide sand backfill a minimum of 4 inches over and under all piping under paved areas.6.In solvent welding, use only the specified primer and solvent cement and make all joints in strict accordance with themanufacturer's recommended methods including wiping all excess solvent from each weld. Allow solvent welds at least 15minutes setup time before moving or handling and 24 hours curing time before filling.7.PVC pipe shall be installed in a manner, which will provide for expansion and contraction as recommended by the pipemanufacturer.8.Centerload all plastic pipe prior to pressure testing.9.All threaded plastic-to-plastic connections shall be assembled using Teflon tape or Teflon paste.10.For plastic-to-metal connections, work the metal connections first. Use a non-hardening pipe dope an all threadedplastic-to-metal connections, except where noted otherwise. All plastic-to-metal connections shall be made with plasticfemale adapters.3.5ControllerA.The exact location of the controller shall be approved by the Landscape Architect or owner's authorized representative beforeinstallation. The electrical service shall be coordinated with this location.1.The Irrigation Contractor shall be responsible for the final electrical hook up to the irrigation controller.2.The irrigation system shall be programmed to operate during the periods of minimal use of the design area.3.6Control WiringA.Low voltage control wiring shall occupy the same trench and shall be installed along the same route as the pressure supply lineswhenever possible.1.Where more than one wire is placed in a trench, the wiring shall be taped together in a bundle at intervals of 10 feet. Bundleshall be secured to the mainline with tape at intervals of 20 feet.2.All connections shall be of an approved type and shall occur in a valve box. Provide an 18-inch service loop at eachconnection.3.An expansion loop of 12 inches shall be provided at each wire connection and/or directional change, and one of 24 inchesshall be provided at each remote control valve.4.A continuous run of wire shall be used between a controller and each remote control valve. Under no circumstances shallsplices be used without prior approval.3.7ValvesA.Automatic control valves, quick coupler, and gate valves are to be installed in the approximate locations indicated on thedrawings.1.Valve shall be installed in shrub areas whenever possible.2.Install all valves as indicated in the detail drawings.3.Valves to be installed in valve boxes shall be installed one valve per box.3.8Valve BoxesA.Valve boxes shall be installed in shrub areas whenever possible.1.Each valve box shall be installed on a foundation of 3/4-inch gravel backfill, 3 cubic feet minimum. Valve boxes shall beinstalled with their tops 1/2 inch above the surface of surrounding finish grade in lawn areas and 2 inches above finish gradein ground cover areas.3.9Irrigation Heads and Drip TubingA.Irrigation heads and drip tubing shall be installed as indicated on the drawings.1.Spacing of heads and drip tubing shall not exceed maximum indicated on the drawings.2.Riser nipples shall be of the same size as the riser opening in the sprinkler body.3.11Miscellaneous EquipmentA.Install all assemblies specified herein according to the respective detail drawings or specifications, using best standardpractices.1.Install devices such as rain sensors as indicated on the drawings and as recommended by the manufacturer.3.12Flushing the SystemA.Prior to installation of irrigation heads, the valves shall be opened and a full head of water used to flush out the lines and risers.B.Irrigation heads shall be installed after flushing the system has been completed.3.13Adjusting the SystemA.Contractor shall adjust valves, align heads, and check the coverage of each system prior to coverage test.B.If it is determined by the Landscape Architect or Owner's authorized representative that additional adjustments or nozzlechanges will be required to provide proper coverage, all necessary changes or adjustments shall be made prior to any planting.C.The entire system shall be operating properly before any planting operations commence.D.Automatic control valves are to be adjusted so that the irrigation heads and drip tubing operate at the pressure recommended bythe manufacturer.3.14Testing and ObservationA.Do not allow or cause any of the work of this section to be covered up or enclosed until it has been observed, tested andaccepted by the Landscape Architect, Owner, and governing agencies.B.The Contractor shall be solely responsible for notifying the Landscape Architect, Owner, and governing agencies, a minimum of48 hours in advance, where and when the work is ready for testing.C.When the sprinkler system is completed, the Contractor shall perform a coverage test of each system in its entirety to determineif the water coverage for the planted areas is complete and adequate in the presence of the Landscape Architect.D.The Contractor shall furnish all materials and perform all work required to correct any inadequacies of coverage due todeviations from the plans, or where the system has been willfully installed as indicated on the drawings when it is obviouslyinadequate, without bringing this to the attention of the Landscape Architect. This test shall be accepted by the LandscapeArchitect and accomplished before starting any planting.E.Final inspection will not commence without record drawings as prepared by the Irrigation Contractor.3.15MaintenanceA.During the maintenance period the Contractor shall adjust and maintain the irrigation system in a fully operational conditionproviding complete irrigation coverage to all intended plantings.3.16Completion CleaningA.Clean up shall be made as each portion of the work progresses. Refuse and excess dirt shall be removed from the site, allwalks and paving shall be broomed, and any damage sustained on the work of others shall be repaired to original conditions.END OF SECTION3.4PipingA.Piping under existing pavement may be installed by jacking, boring, or hydraulic driving. No hydraulic driving is permitted underasphalt pavement.1.Cutting or breaking of existing pavement is not permitted.2.Carefully inspect all pipe and fittings before installation, removing dirt, scale, burrs, and reaming. Install pipe with allmarkings up for visual inspection and verification.3.Remove all dented and damaged pipe sections.4.All lines shall have a minimum clearance of 4 inches from each other and 12 inches from lines of other trades.5.Parallel lines shall not be installed directly over each other.D.All threaded nipples shall be standard weight Schedule 80 with molded threads and shall conform to ASTM D1785.E.All solvent cementing of plastic pipe and fittings shall be a two-step process, using primer and solvent cement applied per themanufacturer's recommendations. Cement shall be of a fluid consistency, not gel-like or ropy. Solvent cementing shall be inconformance with ASTM D2564 and ASTM D2855.F.When connection is plastic to metal, female adapters shall be hand tightened, plus one turn with a strap wrench. Jointcompound shall be non-lead base Teflon paste, tape, or equal.2.5ValvesA. Ball Valves:1.Ball valves shall be of the manufacturer, size, and type indicated on the drawings.8.Contractor shall repair or replace all existing irrigation systems, in areas adjacent to and within the project area of work,damaged by the construction of this project. Adjacent irrigation systems shall be made completely operational and providecomplete coverage of the existing landscaped areas. All repairs shall be complete to the satisfaction of the Owner'sRepresentative.1.6InspectionsA.The Contractor shall permit the Landscape Architect and Owner's authorized representative to visit and inspect at all times anypart of the work and shall provide safe access for such visits.B.Where the specifications require work to be tested by the Contractor, it shall not be covered over until accepted by theLandscape Architect, Owner's authorized representative, and/or governing agencies. The Contractor shall be solely responsiblefor notifying the Landscape Architect, Owner, and governing agencies, a minimum of 48 hours in advance, where and when thework is ready for testing. Should any work be covered without testing or acceptance, it shall be, if so ordered, uncovered at theContractor's expense.SHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 201613+44+)#6+1052'%+(+%#6+1055+Ä RJQURJCVGUCPFUJCNNEQPVCKPOKPKOWOWPCEEGRVCDNGEQPFKVKQPU(+0'(+0+5*)4#&+0)ECWUGYGGFUGGFUVQURTQWV51+.%10&+6+10+0)QHVJGUK\GPQVGFQPFTCYKPIU#'XGPN[FKUVTKDWVGUQKNEQPFKVKQPGTRGTTGEQOOGPFCVKQPUHTQOUQKNUTGRQTVCPFVJQTQWIJN[KPEQTRQTCVGKPVQVJGVQRQHUQKNYKVJC&4GOQXGCNNHQTGKIPOCVGTKCNUTGOQXGENQFUCPFTQEMUNCTIGTVJCPÄKPCP[FKOGPUKQPHTQOUQKNYKVJKPKPEJGUQHHKPKUJITCFG'$TKPIHKPKUJITCFGUVQTGSWKTGGNGXCVKQPUUQVJCVCHVGTEQPFKVKQPKPICPFRNCPVKPIITCFGKUÄDGNQYVQRUQHEWTDUCPFYCNMU5NQRGVQFTCKPVQYCTFCFLCEGPVFTCKPCIGUYCNGUQTECVEJDCUKPU#%QPVTCEVQTUJCNNIGTOKPCVGCPFFGUVTQ[GZKUVKPIYGGFUGGFUDGHQTGRTGRCTKPICTGCUHQTRNCPVKPI5WHHKEKGPVYCVGTUJCNNDGCRRNKGFVQ$7UGQHRTGÄGOGTIGFU[UVGOKEJGTDKEKFGRGTOCPWHCEVWTGTžUKPUVTWEVKQPKURGTOKVVGFRGT.CPFUECRG#TEJKVGEVžUCRRTQXCN('46+.+<'451+.#/'0&/'065#0&%10&+6+10'45#5QKN#OGPFOGPV5JCNNDGPKVTQIGPHQTVKHKGFTGFYQQFEGFCTQTHKTUJCXKPIUOCPWTGRKPGQTQVJGTOCVGTKCNYKNNPQVDGCEEGRVGF5WDOKVUCORNGCPFPWVTKGPVCPCN[UKUCVNGCUVUGXGP  FC[URTKQTVQWUG$%QOOGTEKCNHGTVKNK\GT1TICPKEHGTVKNK\GTHQTOWNCVGFYKVJWPKHQTOKPEQORQUKVKQPFT[CPFHTGGHNQYKPI2TQXKFGHGTVKNK\GTEQPVGPV%#ITKEWNVWTCNI[RUWO5VCPFCTFEQOOGTEKCNSWCNKV[OCPWHCEVWTGFHQTWUGCUCUQKNCOGPFOGPVCUCRRTQXGFD[.CPFUECRG#TEJKVGEVCPFRGTUQKNUTGRQTV(QTDKFFKPIRWTRQUGUQPN[WUG  NDUUH&5QKNUWNHWT5VCPFCTFEQOOGTEKCNSWCNKV[OCPWHCEVWTGFHQTWUGCUCUQKNCOGPFOGPVCUCRRTQXGFD[.CPFUECRG#TEJKVGEVCPFRGTUQKNUTGRQTV(QTDKFFKPIRWTRQUGUQPN[WUGQPG  NDUH/+5%'..#0'175/#6'4+#.5#6TGGUVCMGU.QFIGRQNGRKPGRQKPVGFQPQPGGPF5VCKPGPVKTGNGPIVJYKVJITGGPUJKPINGUVCKP2TQXKFGKPFKCOGVGTD[HVNQPIUVCMGU$6TGGVKGUž%KPEJÄVKGQTCRRTQXGFGSWCN%*GTDKEKFGU%QOOGTEKCNSWCNKV[RTGÄGOGTIGPVV[RGCUCRRTQXGFD[CNKEGPUGFRGUVEQPVTQNCFXKUGTCPF.CPFUECRG#TEJKVGEVHQTWUGYKVJ*GTDKEKFGUJCNNGHHGEVKXGN[EQPVTQNCNNDTQCFNGCHITQWPFEQXGTITQYVJHQTCRGTKQFQHPQVNGUUVJCPOQPVJU&/WNEJ-GNNQIžU(KT$CTM Ä 24'Ä+052'%6+10 $[%QPVTCEVQT #'ZCOKPGUKVGHQTEQPFKVKQPUVJCVYKNNCFXGTUGN[CHHGEVGZGEWVKQPRGTHQTOCPEGCPFSWCNKV[QHYQTM$+OOGFKCVGN[PQVKH[VJG.CPFUECRG#TEJKVGEVKPYTKVKPIFGUETKDKPICP[##NNHNQYNKPGUUJCNNDGOCKPVCKPGFVQCNNQYHTGGFTCKPCIGQHUWTHCEGYCVGT&KURNCEGFOCVGTKCNYJKEJKPVGTHGTGUYKVJFTCKPCIGUJCNNDGTGOQXGFCPFRNCEGFCUFKTGEVGF.QYURQVUUJCNNDGTGOQXGFCPFRNCEGFCUFKTGEVGF.QYURQVUUJCNNDGITCFGFVQFTCKPRTQRGTN[$#NNTQEMFGDTKUCPFOKUEGNNCPGQWUHQTGKIPOCVVGTUJCNNDGTGOQXGF%(KPKUJITCFGCNNRNCPVKPICTGCUVQCUOQQVJGXGPEQPFKVKQP/CMGUWTGVJCVPQYCVGTRQEMGVUQTKTTGIWNCTKVKGUTGOCKPURGEKGUQHRNCPVUURGEKHKGFQP2NCPVKPI2NCPU#2NCPVUUJCNNDGRNCPVGFYJGTGUJQYPQPRNCPUCPFCUFKTGEVGFD[VJG$0QRNCPVUUJCNNDGVTCPURQTVGFVQVJGRNCPVKPICTGCVJCVCTGPQVVJQTQWIJN[OQKUVVJTQWIJQWVVJGDCNNQHGCTVJUWTTQWPFKPIVJGTQQVU2NCPVUUJQWNFPQVDGCNNQYGFVQFT[QWVPQTUJCNNCP[TQQVUDGGZRQUGFVQVJGCKTGZEGRVFWTKPIVJGCEVQHRNCEGOGPV#P[RNCPVUVJCVKPVJGQRKPKQPQHVJG.CPFUECRG#TEJKVGEVCTGFT[QTKPCYKNVGFEQPFKVKQPYJGPFGNKXGTGFQTVJGTGCHVGTYJGVJGTKPRNCEGQTPQVYKNNPQVDGCEEGRVGFCPFUJCNNDGTGRNCEGFCVVJG%QPVTCEVQTžUGZRGPUG%2NCPVRKVUHQTEQPVCKPGTRNCPVUUJCNNJCXGXGTVKECNUKFGUCPFUJCNNDG&$CEMHKNNOKZUJCNNDGFGVGTOKPGFD[UQKNVGUVCUURGEKHKGFCDQXG(QTDKFRWTRQUGUQPN[DCEMHKNNOCVGTKCNHQTRNCPVRKVUUJCNNDG#RRTQXGFUQKNRCTVUD[XQNWOGPCVKXGUQKN1TICPKECOGPFOGPVRCTVUD[XQNWOG%QOOGTEKCNHGTVKNK\GTNDRGTEW[CTF5QKNUWNHWTNDURGTEW[CTF'$CEMHKNNHQTUJCFGRNCPVUUJCNNDGQPGRCTVRTGRCTGFDCEMHKNNOKZRGTPQVGž&žCDQXGCPFRCTVUUCVWTCVGFEQCTUGRGCVOQUU(6JGDCEMHKNNOCVGTKCNUUJCNNDGVJQTQWIJN[OKZGFVQVJGDQVVQOQHVJGRKVUQVJCVVJG[CTGGXGPN[FKUVTKDWVGFCPFYKVJQWVENQFUQTNWORU)$CEMHKNNUJCNNDGUQRNCEGFKPVJGRKVUVJCVVJGRNCPVYKNNDGCVKVUPCVWTCNITQYKPIJGKIJVCPFVJGDCEMHKNNOCVGTKCNYKNNDGNGXGNKPEJDGNQYUWTTQWPFKPIUQKNITCFGCHVGTUGVVNGOGPV*(QTOUJCNNQYDCUKPCTQWPFGFIGQHRNCPVRKV+)TCFGCTGCTQWPFRNCPVVQHKPKUJITCFGOGEJCPKECNVKNNGT(QTDKFFKPIRWTRQUGUQPN[WUG5QKNCOGPFOGPV[CTFURGTUSHV(GTVKNK\GTNDURGTUSHV#ITKEWNVWTCN)[RUWONDURGTUSHV2TQVGEVVJGKPUVCNNGFYQTMCPFOCVGTKCNUQHQVJGTVTCFGUCRRTQXCNRTKQTVQFGNKXGT[VQUKVG2.#06/#6'4+#.5TGRNCEGFYKVJUWKVCDNGRNCPVU2TQVGEVOCVGTKCNUDGHQTGFWTKPICPFCHVGTKPUVCNNCVKQP#+ORQTVVQRUQKNUJCNNDGWPKHQTOKPEQORQUKVKQPHTKCDNGUCPF[NQQOHTGGQHTQQVUENQFUUVQPGU QPGKPEJQTNCTIGT PQZKQWUYGGFUQTUVKEMU+VUJCNNPQVDGKPHGUVGFYKVJPGOCVQFGUQTQVJGTRGUVUQTFKUGCUGQTICPKUOU$5WDOKVVQRUQKNUCORNGNQECVKQPQHUQWTEGCPFVGUVUQKNHQTPWVTKGPVURJUQKNVGZVWTGCPFUCNVUCVNGCUVFC[UDGHQTGUEJGFWNGWUG%6QRUQKNUCORNGOWUVTGEGKXGNCDQTCVQT[CPF.CPFUECRG#TEJKVGEVžU##NNRNCPVUUJCNNDGYGNNHQTOGFXKIQTQWUVTWGV[RGCPFHTGGHTQOFKUGCUGKPUGEVUCPFFGHGEVUUWEJCUMPQVUUWPUEQNFYKPFDWTPCDTCUKQPQTFKUHKIWTGOGPV#NNRNCPVUUJCNNJCXGXKIQTQWUCPFHKDTQWUTQQVU[UVGOUYJKEJCTGPGKVJGTTQQVDQWPFQTRQVDQWPFCPFCTGHTGGQHMKPMGFQTIKTFNGF$2NCPVUUJCNNDGVCIIGFCVPWTUGT[D[VJG.CPFUECRG#TEJKVGEVRTKQTVQFGNKXGT[VQUKVGCPFKPURGEVGFWRQPCTTKXCNVQVJGUKVG2NCPVUPQVCRRTQXGFD[VJG.CPFUECRG#TEJKVGEVUJNNDGTGOQXGFHTQOVJGUKVGKOOGFKCVGN[CPFVJG.CPFUECRG#TEJKVGEVHQTCRRTQXCNCPFCOGPFOGPVUCPFDCEMHKNNTGEQOOGPFCVKQPUUJCNNDGUGPVFKTGEVN[VQVGUVUQKNPWVTKGPVU2JUQKNVGZVWTGCPFUCNVU#EQR[QHVJGVGUVTGUWNVUÄFGGRCPFUWDOKVVJGUGVQCNQECNUQKNVGUVKPINCDQTCVQT[.CDUJCNN#6JG%QPVTCEQVUJCNNVCMGVYQGZKUVKPIUQKNUCORNGUHTQOFKHHGTGPVCTGCU51+.6'565TQQVU2#46Ä/#6'4+#.5+/214651+..CPFUECRG#TEJKVGEV2.#06+0)2.#06+0)52'%+(+%#6+105#(KPG(KPKUJ)TCFKPI5%12'1(914-UVCTVKPICP[CP[YQTMQHVJKUUGEVKQP241&7%6*#0&'.+0).CPFUECRG#TEJKVGEVHQTEQPUKFGTCVKQP5VQTGCNNOCVGTKCNUKPCPQTFGTN[OCPPGTCPFNQECVGUQCUVQCXQKF5GEWTG1YPGTžURGTOKUUKQPVQUVQTGRNCPVOCVGTKCNUQPVJGRTQLGEVCPCN[UKUCPF/CPWHCEVWTGTžUPCOGCPFDTCPFOCPWHCEVWTGTžUQTKIKPCNWPQRGPGFEQPVCKPGTUENGCTN[NCDGNGFYKVJYGKIJV#&GNKXGT[&GNKXGTCNNHGTVKNK\GTUQKNCOGPFOGPVCPFJGTDKEKFGUKPUWDOKVCRTQRQUCNVQRTQXKFGVJGPGCTGUVGSWKXCNGPVUK\GQTXCTKGV[VQVJG$+HCURGEKHKGFRNCPVURGEKGUQTXCTKGV[KUPQVQDVCKPCDNG%QPVTCEVQTOC[#5WDUVKVWVKQPUYKNNPQVDGRGTOKVVGFYKVJQWVYTKVVGPCRRTQXCND[.CPFUECRG#6JGKTTKICVKQPU[UVGOUJCNNDGKPUVCNNGFCFLWUVGFCPFCRRTQXGFDGHQTG)5KZV[&C[  2NCPV'UVCDNKUJOGPVCPF/CKPVGPCPEG2GTKQF&(WTPKUJKPICPF2NCPVKPI8KPGU6TGGUCPF)TQWPFEQXGTYKVJCRRTQXGFEQXGTCIG5VQGTHGTVKNK\GTCDQXGITQWPFCPFRTQVGEVHTQOOQKUVWTGCDUQTRVKQPRTKQTVQRNCPVKPI/CKPVCKPYCVGTKPIQHRNCPVUQPCTGIWNCTUEJGFWNG2TQVGEVCNNRNCPVUHTQOFCOCIGD[UWPYKPFCPFTCKPCVCNNVKOGUKPVGTHGTKPIYKVJQVJGTEQPUVTWEVKQPCEVKXKVKGU%2TQVGEVKQPUKVG$5VQTCIG57$56+676+105#TEJKVGEV(6TGGUVCMKPI'6WTHUQFFKPI%5QKN2TGRCTCVKQP$5QKN(GTVKNKV[6GUVU#22418#.52#46Ä)'0'4#.9''&%10641.2#46':'%76+10PKVTQIGPRGTUQKNUTGRQTVCTGCUJKUYQTM4GOQXGCNNVCIUNCDGNUPWTUGT[UVCMGUCPFVKGUHTQOVJG##YTKVVGPPQVKEGTGSWGUVKPICPKPURGEVKQPUJQWNFDGUWDOKVVGFVQVJG3WCPVKV[QHUQKNCOOGPFOGPVU3WCPVKV[QHJ[FTQOWNEJOCVGTKCNU3WCPVKV[QHCITKEWNVWTCNI[RUWO3WCPVKV[QHEQOOGTEKCNHGTVKNK\GTWUGF#VEQORNGVKQPQHVJGOCKPVGPCPEGRGTKQFCPFCNNGZEGUUOCVGTKCNCPFFGDTKUTGOQXGF.CPFUECRG#TEJKVGEVWRQPFGNKXGT[VQVJGLQDUKVGKPENWFG#9TKVVGPEGTVKHKECVKQPUTGSWKTGFYJKEJCTGVQDGUWDOKVVGFVQVJG'0&1(5'%6+10KPURGEVKQPCPFCRRTQXCNQHCNNNCPFUECRGEQPUVTWEVKQPKVGOURGTKQFVJG%QPVTCEVQTYKNNDGTGSWKTGFVQJCXGCEQORNGVGRTKQTVQVJGUVCTVQHVJGECNGPFCTFC[RTQLGEVOCKPVGPCPEG#VVJGGPFQHVJGECNGPFCTFC[GUVCDNKUJOGPVRGTKQFCPFFCVG2TKQTVQVJKUKPURGEVKQPVJGUKVGOWUVDGVJQTQWIJN[ENGCPGFWR$6JGHQNNQYKPIOCKPVGPCPEGKPURGEVKQPUCTGTGSWKTGF.CPFUECRG#TEJKVGEVCVNGCUVHKXG  FC[URTKQTVQVJGCPVKEKRCVGF(2TQLGEVOCKPVGPCPEGYQTMUJCNNEQPUKUVQHCRRN[KPIYCVGTYGGFKPIECTKPIHQTRNCPVUUYGGRKPIYCNMUNKVVGTRKEMÄWRCPFRGTHQTOKPICNNIGPGTCNRTQLGEVOCKPVGPCPEGRNCPVU#NNRCXGFCTGCUUJCNNDGUYGRVENGCPCPFVJGUKVGNGHVKPCPGCVCPFCEEGRVCDNGEQPFKVKQPCUCRRTQXGFD[VJG.CPFUECRGVJG.CPFUECRG#TEJKVGEV#%QPVTCEVQTUJCNNIWCTCPVGGCNNRNCPVUICNNQPCPFNCTIGTHQTCRGTKQFQHQPG[GCT#NNQVJGTRNCPVUUJCNNDGSWCTCPVGGFHQTCRGTKQFQHFC[U2NCPVUYJKEJFKGQTNQUGOQTGVJCPNGCXGUFWTKPIVJKURGTKQFUJCNNDGTGRNCEGF4GRNCEGOGPVUUJCNNDGOCFGYKVJKPFC[UQHYTKVVGPPQVKHKECVKQPVQ%1PVTCEVQT##P[GZVTCUQTTGXKUKQPUVQVJGRNCPUCTGVQDGCRRTQXGFKPYTKVKPID[##YTKVVGPPQVKEGTGSWGUVKPICPKPURGEVKQPUJQWNFDGUWDOKVVGFVQVJG.CPFUECRG#TEJKVGEVCVNGCUVFC[URTKQTVQVJGCPVKEKRCVGFFCVG2TKQTVQVJKUKPURGEVKQPVJGUKVGOWUVDGVJQTQWIJN[ENGCPGFWRCPFCNNGZEGUUOCVGTKCNCPFFGDTKUTGOQXGF6JGHQNNQYKPIKPURGEVKQPUUJCNNDGRGTHQTOGFD[VJG.CPFUECRG#TEJKVGEV#VEQORNGVKQPQHUQKNRTGRCTCVKQPCPFHKPKUJITCFKPI2NCPVOCVGTKCNUCHVGTFGNKXGT[VQUKVGDWVRTKQTVQRNCPVKPI2NCPVNQECVKQPURTKQTVQRNCPVKPI(KPKUJITCFKPIRTKQTVQRNCPVKPI(KPCNEQPUVTWEVKQPKPURGEVKQPRTKQTVQOCKPVGPCPEG(KPCNCEEGRVCPEGCVVJGGPFQHOCKPVGPCPEGRGTKQF$6JGRNCPVGUVCDNKUJOGPVRGTKQFEQOOGPEGUYJGPCNNRNCPVUCPFCNN241,'%6/#+06'0#0%'#2TQLGEVOCKPVGPCPEGEQPUKUVUQHCOKPKOWOÄFC[RNCPVGUVCDNKUJOGPVRGTKQFCPFCÄFC[OCKPVGPCPEGRGTKQFCNNVWTHCTGCUJCXGDGGPOQYGFVQVJGURGEKHKGFJGKIJVCVNGCUVQPEGOQKUVDWVPQVINKUVGPKPIYGVWPVKNVKOGHQTVJGHKTUVEWVVKPIQHITCUU&6JGGUVCDNKUJOGPVRGTKQFUJCNNDGGZVGPFGFDG[QWPFVJGÄFC[OKPKOWOCVPQEQUVVQVJG1YPGTWPVKNCNNVWTHCTGCUCTGGUVCDNKUJGFCPFDGGPOQYGFVQVJGURGEKHKGFJGKIJVCPFVQVJGUCVKUHCEVKQPQHDWVPQVNGUUVJCPFC[U%9CVGTITCUUWPVKNCEEGRVCPEGQHYQTM6JGCTGCUUJCNNDGMGRV#HVGTHKTUVEWVVKPIYCVGTNCYPVQOCKPVCKPCVJTKXKPIEQPFKVKQPVJG.CPFUECRG#TEJKVGEV'2TQLGEVOCKPVGPCPEGYQTMUJCNNEQOOGPEGCHVGTVJG.CPFUECRG#TEJKVGEVJCUCRRTQXGFRNCPVGUVCDNKUJOGPVCPFEQPVKPWGHQTCPVWTHJCXGDGGPRNCPVGF6JGGUVCDNKUJOGPVRGTKQFYKNNEQPVKPWGWPVKNCFFKVKQPCNFC[U':64#5+052'%6+105)7#4#06''5#TEJKVGEVQHVJGKTQTKIKPCN%'46+(+%#6+103WCPVKV[QHUGGF3WCPVKV[QHKTQPUWNHCVG#VVJECNGPFCTFC[3WCPVKV[QHUQKNUWNHWT+052'%6+105CVPQCFFKVKQPCNEQUVVQVJG1YPGTPGCVEQPFKVKQPWPVKNCEEGRVCPEGQHVJGYQTMYTKVKPID[VJG.CPFUECRG#TEJKVGEVNCYPYKNNDGCSGSWCVGN[YCVGTGFCVCNNVKOGUCUTGSWKTGFVQOCKPVCKPJGCNVJ[XKIQTQWUITQYVJCVVJGTCVG+OOGFKCVGN[RTKQTVQGPFQHOCKPVGPCPEGRGTKQFTGEQOOGPFGFD[VJGUQKNUTGRQTVCVVJGHQNNQYKPIRGTKQFU.#P[FCOCIGVQRNCPVKPICTGCUUJCNNDGTGRCKTGFKOOGFKCVGN[YKNNDGEWVVQPQVNGUUVJCDÄCPFFWTKPIVJGRGTKQFQHITCUUCPFOCKPVCKPVJGVWTHWPVKNCJGCNVJ[OCVWTGVWTHKU1+PQTFGTVQECTT[QWVVJGRTQLGEVOCKPVGPCPEGYQTMVJG%QPVTCEVQTECNGPFCTFC[UHQNNQYKPIDGIKPPKPIFCVGQHOCKPVGPCPEGECNGPFCTFC[UHQNNQYKPIDGIKPPKPIFCVGQHVJGOCKPVGPCPEG06JG%QPVTCEVQTUJCNNRTQXKFGVJTGGUWRRNGOGPVCNHGGFKPIUQHHGTVKNK\GT/%QPVTCEVQTUJCNNEQPVKPWGVQRKEMWRTQEMUVJCVUWTHCEGCPFCTGQTDGGPFCOCIGFQTEQORCEVGFUJCNNDGTGEWNVKXCVGFCPFTGÄUQFFGFCVDGHQTGFWTKPIQTCHVGTUQFFKPIQRGTCVKQPU)TCUUCTGCUVJCVJCXG-9QTMOGPUJCNNPQVDGCNNQYGFVQYCNMQPITCUUCTGCUWPPGEGUUCTKN[CYC[HTQOVTGGVTWPMU6JGNCYPGFIGUUJCNNDGOCKPVCKPGFKPCKPVJGITCUUCTGCUVJGITCUUUJCNNDGVWTPGFWPFGTCPFPGCVN[GFIGF,+OOGFKCVGN[CHVGTVJGUGEQPFEWVVKPIQHITCUUCPFYJGTGVTGGUQEEWTOCKPVGPCPEGVJGITCUUYKNNPQVDGCNNQYGFVQGZEGGFKPJGKIJVOQYGFYKVJCUJCTROQYGTDGHQTGGZEGGFUKPJGKIJV6JGITCUU+6JGITCUUUJCNNDGGFIGFYJGPGXGTPGEGUUCT[6JGITCUUUJCNNDGCPFNCYPCTGCURNCPVGFQPVJGYKPFYCTFCPFQTUWPP[UKFGUQVJCVQHKPCRTQRGTOCPPGT2TQXKFGURGEKCNCVVGPVKQPHQTYCVGTKPIUNQRGU,QJPUQPITCUUCPF$TCOWFCITCUUUJCNNDGTGOQXGFCPFFKURQUGFHTGGCVCNNVKOGU9GGFUCPFPQZKQWUITCUUGUUWEJCU&CNNCUCPF*#NNRNCPVUCPFRNCPVGFCTGCUUJCNNDGMGRVYGNNYCVGTGFCPFYGGFTGÄGUVCDNKUJGFCPFUJCNNOCKPVKCPVJCVCTGCHQTCPCFFKVKQPCNFC[UEQPFKVKQPUCTGPQVEQORNKGFYKVJVJG%QPVTCEVQTUJCNNTGRNCPVVJGCPFUJCNNKOOGFKCVGN[CRRN[TGOGFKGU+HVJGCDQXGCPFHQNNQYKPIOCPKHGUVGF*GUJCNNVCMGKOOGFKCVGCEVKQPVQKFGPVKH[VJGRTQDNGOFGHKEKGPEKGUVWTHFKUGCUGUCPFRGUVUCUUQQPCUVJGKTRTGUGPEGKU)6JG%QPVTCEVQTUJCNNDGTGURQPUKDNGHQTFGVGEVKPIPWVTKGPVUJCNNOCKPVCKPCUWHHKEKGPVPWODGTQHOGPCPFCFGSWCVGGSWKROGPVVQQHVJGRTQLGEVOCKPVGPCPEGRGTKQFQTWPVKNVJGHKPCNCRRTQXCNUCVKUHCEVQT[EQORNGVGCPFVJGRTQLGEVOCKPVGPCPEGKUCEEGRVGFKPKPVJGUGRTQXKUKQPUYJGPVJGRTQLGEVOCKPVGPCPEGYQTMJCUDGGP26JG%QPVTCEVQTOC[DGTGNKGXGFHTQOVJGOCKPVGPCPEGYQTMTGSWKTGFWPVKNVJGGPFQHVJGRTQLGEVOCKPVGPCPEGRGTKQFQTWPVKNVJGGPFQHVJGRGTHQTOVJGYQTMJGTGKPURGEKHKGFHTQOVJGVKOGCP[RNCPVKPIKUFQPGTGRNCEGFKPMKPFCVVJGGZRGPUGQHVJG%QPVTCEVQTHKNNKPIYKVJVQRUQKNCPFNGXGNKPI4GÄUGGFFCOCIGFQPGVQNCYPVJGOWPUWKVCDNGHQTVJGRWTRQUGKPVGPFGFUJCNNDGKOOGFKCVGN[$'ZVGTOKPCVGIQRJGTUCPFOQNGUD[VTCRRKPICPFTGRCKTFCOCIGD[QHVJGEQPVTCEVQTVJQUGRNCPVUUQKPLWTGFQTFCOCIGFCUVQTGPFGT##NNRNCPVUVJCVUJQYUKIPUQHHCKNWTGVQITQYCVCP[VKOGFWTKPIVJGNKHG#+OOGFKCVGN[CHVGTRNCPVKPICRRN[YCVGTVQGCEJRNCPVD[OGCPUQHCJQUG#RRN[YCVGTKPCOQFGTCVGUVTGCOKPVJGRNCPVKPIJQNGWPVKNVJGOCVGTKCNCDQWVVJGTQQVUKUEQORNGVGN[UCVWTCVGFHTQOVJGDQVVQOQHVJGJQNGVQVJGVQRQHVJGITQWPF#2TWPGQPN[CUPGEGUUCT[VQTGOQXGKPLWTGFVYKIUCPFDTCPEJGU$2TWPGRNCPVUKPCEEQTFCPEGYKVJUVCPFCTFJQTVKEWNVWTCNRTCEVKEG2TWPKPIUJCNNDGRGTHQTOGFD[SWCNKHKGFCTDQTKUV%5GCNCNNEWVUKPKPFKCOGVGTQTNCTIGTYKVJCUCRRNKECVKQPQH#7RQPEQORNGVKQPQHCNNRNCPVKPIYQTMCPFDGHQTGCEEGRVCPEG%QPVTCEVQTUJCNNTGOQXGCNNOCVGTKCNCPFFGDTKUTGUWNVKPIHTQO6TGG5GCNQTGSWCN%QNQTQHUGCNCPVVQOCVEJVTWPM&QPQVWU2470+0)FGCFYQQFCPFUWEMGTUNGCFDCUGFRCKPVU%.'#0729#6'4+0)4'2.#%'/'061(2.#065RGTKQFRGTKQFITGCVGTKPFKCOGVGTVJG%QPVCEVQTžUGZRGPUGCXCKNCDNG*WOKECEKF(GTVKNK\GTVQDGCXCKNCDNGPKVTQIGP/CVGTKCNEQPVCKPKPI2QVCUJSHEETSHEETSFILE NO.OF28052 Camino Capistrano,Suite 211Laguna Niguel, CA 92677Phone: 949 683.1941Fax: 949 347.8305CITY OF LAKE ELSINORETRACT NO. 32996MODEL COMPLEX AND SALES TRAILERLANDSCAPE PLANPLOT DATE DECEMBER 27 2016132.#06+0)52'%+(+%#6+1052&Ä